CAZyme Information: RL4_JR_02497-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_02497-RA-p1
• CAZy Family: CE1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	JACBXF010000032|CGC14	46918.92	7.0200

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000032:2727927-2729276(+)

Full Sequence      

MRRFHSLLLGLLATPLSLVSAQSASSGSGLHSLAVAAGKLFFGTATDTNLFNDTAYMAIV
SNRSEFGILVPENSQKWQPTEPRQNSFVFTSPDSVRSLAQANQQQFRCHTLTWFQQLPQF
VTTTAWTRATLTAAIQAHIANVVGHFRGQCYSWDVVNEALNDNGTFRSSVFFQTLGTDYI
PISFVAAAAADPDARLYYNDFSLEFNSSKTEAALAIVRLVRAAGARIDGVGFQAHMVVGQ
TPSRAALAGVLGRFTGLGLEVALTELDVRQPSLPASAAMVQKQSADYVSVVGACLDVAAC
VGIVAWEYTDKYSWVPSTFPGAGAACLFDENLVPKPAYTAVRNLLAGAANRTNTTRTSTG
ATLSTASGFAGNFGGTPGSVSAADVSGSNDTGVSAAAAAVTSAPLQSATPDASVVVAANA
ALSTSSALVRRIPTGAALVAAIFVLPLVW

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	35	343	2.8e-88	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	2.67e-120	30	343	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	3.33e-93	76	341	2	263	Glycosyl hydrolase family 10.
226217	XynA	2.58e-70	63	349	55	345	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS45856.1|GH10	3.26e-157	3	349	2	346
UQC78947.1|GH10	3.84e-146	26	349	20	343
QBZ55005.1|GH10	2.18e-143	25	349	33	357
AAN60060.1|GH10	3.54e-142	25	349	33	357
AEO63155.1|GH10	6.58e-140	20	347	23	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	4.86e-119	28	347	1	316	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	6.20e-118	26	347	21	338	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	6.66e-97	26	345	1	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUF_A	4.42e-88	30	341	5	308	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	1.11e-85	30	341	5	308	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J1Y4|XYN5_MAGGR	6.29e-143	25	349	33	357	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|G4MLU0|XYN5_MAGO7	6.29e-143	25	349	33	357	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|P79046|XYN1_HUMGT	3.67e-119	23	346	14	338	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	4.82e-114	30	341	21	330	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	1.62e-104	25	341	79	393	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000308	0.999663	CS pos: 21-22. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_02497-RA-p1.