CAZyme Information: RL4_JR_01764-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_01764-RA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	JACBXF010000032|CGC5	39345.57	4.5109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000032:499728-500831(+)

Full Sequence      

MQLLTCLLWFLAAPVLAWPLEVVERDVEPRAEGLPRLVIYFQSAHDSSGRPISLLPLITE
KGIALTHLIVCSFHINAGSQLVLNDWAPSDARFSTMWNETAILREAGVKVMGMVGGYAAG
SFANSTLDGGSRAFETYYRQLHDTIVTFGLQGMDLDVEQAMSQAGIQRLVARLRADFGAD
FVITLAPVASALQPGGPNLSGFDYAQLEAAQGDAISFYNAQFYSGFGTLATPADFQRVVA
AGWAPDKILLGELTSAANGAGYVPLDVVNQTVTSLRRTYGTLGGVMGWEYFNSQPGGTAK
PWEWAQQMTAILRPGQVATLSVTADDAQRLNTAWRASVVKSAVAAADTEGNTQEITPNVD
YAAMVNA

Enzyme Prediction     

EC	3.2.1.96:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	37	280	3.4e-17	0.6959459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	2.64e-136	36	293	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	2.52e-15	65	223	24	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119356	GH18_hevamine_XipI_class_III	3.12e-08	104	298	69	273	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
119350	GH18_chitinase_D-like	3.17e-08	103	288	69	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
226000	Chi1	3.86e-04	145	265	130	255	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI74194.1|GH18	9.07e-137	2	366	1	355
CAL49863.1|GH18|3.2.1.96	3.31e-135	11	367	11	359
CAL49862.1|GH18|3.2.1.96	9.43e-135	10	367	6	359
CAZ16624.1|GH18|3.2.1.96	9.43e-135	10	367	6	359
ATY67196.1|GH18	4.68e-134	11	367	11	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AC1_X	7.99e-126	34	315	2	282	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
2Y8V_A	4.38e-75	29	309	4	285	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

RL4_JR_01764-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999749	CS pos: 17-18. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_01764-RA-p1.