CAZyme Information: RL4_JR_01607-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_01607-RA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
900	JACBXF010000169|CGC22	99327.75	4.9678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000169:4898802-4901504(-)

Full Sequence      

MASHIVVPIDQGWQFKQADKDDSHWLPVGQFPTNIHLDLLAHNKIPDPFIGKNEQQVQWV
GERQWAYKTTFALPADDGGGSSGDRKTVLAFDGLDTFATVVLNGQTILESDNMFLPARVD
VTAVVRPAAQDNELCITFDSAYLRGWELVEKHADHKWGCWNGDSSRLAVRKAQYHWVCLE
TVATVAAGGDADKRQGWDWGPMLMTCGPWRPIYLEVYEARLADLFFDTAVDESLQSATVV
AHAVVEWAAAAAAKAAAVRFDVVLDGSAVTTATVAVDAATASASATFHIRHPALWYPVGY
GGQPLYAVQATLLQGGTGGGVVDAATKKIGLRRAELVQRPVEEQPGTSFFFRINNVPIFC
GGSDWIPADNFLPRVTEARYREWVRLVAEGNQCMIRVWGGGIYEAAAFYDACDELGVLVW
QDFMFGCGNYPAWPALRASIRQEAEANVRLLRHHASIVIWAGNNEDYQYQESEQLTYDYA
NQDADSWLQTDFPARYIYEKILAEVCAALVPGTAYHYGSPWGGGVDTHDPTVGDIHQWNV
WHGTQERYQNFDRLVGRFVSEFGMEAFPSVRTIDAFLPLGAADPERFAQSATVDWHNKAD
GHERRLALYLVENLRYAPDPLEQYVYSTQLMQAECLATAYRLWRRQWQGPGREYCGGALV
WQINDCWPVTSWSICDYYRRPKLAYYAVKRALATVSVGLVRRERVVGGTPRNRHSRVDED
GTQRIAQVEVWGSSLALADRTVDCVVRAWDVETGRLTGEQRVATAVRLAANRSTEIAVVD
IPGQAGDAAAAQTVVAAYLVDGQGEQVARYVSWPEPLKYLHLTRPQALVAALSAGGDAVE
VRAEVPVKGVAVEVVAGSDAEADAVVFADNLVDIVPGEVVRIGVRGVTAATQFATRYLGM

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	780	2.9e-96	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	3.23e-67	8	772	14	713	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.20e-11	727	819	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236673	ebgA	8.81e-06	66	155	112	210	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC87618.1|GH2	0.0	1	900	26	875
AFJ59925.1|GH2|3.2.1.25	0.0	1	900	1	854
AEO53082.1|GH2	0.0	1	900	1	854
AEO69937.1|GH2	0.0	1	900	1	850
EAA35570.1|GH2	0.0	1	900	1	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.47e-120	1	702	21	663	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	5.04e-101	6	702	8	661	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	5.26e-101	6	702	10	663	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	5.38e-101	6	702	10	663	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.38e-100	6	702	8	661	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	1	900	1	854	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	4.34e-266	1	886	1	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	5.63e-264	8	886	8	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	5.63e-264	8	886	8	830	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	3.20e-263	8	886	8	830	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_01607-RA-p1.