CAZyme Information: RL4_JR_01384-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_01384-RA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		41734.73	4.5214

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000169:4222018-4223243(-)

Full Sequence      

MFALSFFFTTALAASSLPKDLQVNDTASILGVAKNLASGVMSYYPGSAKAYADLPAPYYW
WECGALFGAMLDYSHYTGDTQYDEKIATAVMAQAGPNNDYMLPAHYGDEGNDDQAFWGFA
VMSAAERNFSQPAALTPTGVPGWLTLGTNIWGSLVSRWNTTHCNGGFTWQIFASNPNGLN
YKNSVSNGGVFQLSARLAKLTGNATYLDWAARIWDWTEGVGLIDSQWAVYDGVGAEDNCS
TVNPLSFSYAAGIYLYGAAVLANHTGSAVWAARAAGLLQGTQSFFGPFDNASNIMWEHAC
EGVNTCNTDMKSFKGYLARFMYAAAAVQPSLAPTVATYMRASAQAAGIACSGPTTNASAV
CGQKWYVGGFDNSVGLGQQMSALEAIQGLLVL

Enzyme Prediction     

No EC number prediction in RL4_JR_01384-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	27	390	1.5e-88	0.9245810055865922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	9.43e-141	28	383	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.82e-08	58	346	44	306	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70787.1|GH76	6.47e-177	10	391	14	389
AEO60662.1|GH76	2.53e-176	9	391	13	389
VBB73902.1|GH76	1.43e-157	18	392	22	390
CDP24660.1|GH76	8.18e-157	18	392	22	390
CAP67249.1|GH76	8.18e-157	18	392	22	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	6.81e-78	22	391	29	404	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	1.52e-95	20	386	20	378	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.13e-93	12	389	15	386	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	4.17e-93	20	386	23	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	6.76e-90	20	392	21	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	4.00e-88	21	391	21	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.114333	0.885646	CS pos: 13-14. Pr: 0.8504

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_01384-RA-p1.