CAZyme Information: RL4_JR_01361-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_01361-RA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	JACBXF010000169|CGC21	64493.55	5.0845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000169:4155498-4157380(-)

Full Sequence      

MSKQYDYIVVGGGTAGLVVAARLTENPEINVLVVEAGGDRTKDPLVLTPGLLPAVYGKEE
YDWAFLSTPQASLHNRIIPQARGRMLGGSSALNFFMVVFPGRAVLDAWGELGNEGWSFDA
LAPYFRKFGKTTAPPETVLEVSRLRGHYDPAITATETGPLPISFSEYNASNSSWMDAFAK
LGLEATADPRSGTTFGAFQQAASIDPATHTRAFSASAYLDDAIRARPNLEVLTDTVVSRI
VLETDAEGGAAVAKGVVVQPAAGGPERTIAARREVVLAAGALQSPQILELSGIGGRALLT
KHGIPIVVDNPGVGENMQDHPIVCQTREVNDGVVTSDVLRDPALLQAVLALYQDGGQGPL
GQSPISCAYAPLVDGKGILPVEARKALLDKTLPDGKNRLAAKASQLVRGILEQEKEPGVQ
FLLFPGQTNIKPTGDISGILVPARPQNCITVMTILNHPFSRGACHIASPRVEDKPVWDPR
YNEVAADLEILANGVKFAETLVHTPPFADLFKKDGLRWPDLAPTDDEAAREIVRQAQISV
FHVTGSCAMAPRELGGVVDSKLQVYGVKGLRVVDASVFPIEPLGNIQTTVYAVAEKAADL
IKADW

Enzyme Prediction     

No EC number prediction in RL4_JR_01361-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	604	1.6e-174	0.9982394366197183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.45e-96	1	602	2	532	choline dehydrogenase; Validated
225186	BetA	1.64e-94	1	604	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.02e-36	458	597	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.67e-34	71	322	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.55e-33	5	590	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD60572.1|AA3_2	1.14e-226	1	604	6	604
CDP29465.1|AA3_2	1.14e-226	1	604	6	604
VBB81258.1|AA3_2	9.25e-226	1	604	6	604
AEO60130.1|AA3_2	1.79e-221	1	604	7	607
UKZ60559.1|AA3_2	1.61e-215	2	604	5	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.88e-72	3	604	4	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	3.50e-68	2	604	3	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.20e-65	4	604	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
5ZU3_A	1.11e-64	3	604	5	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	1.11e-64	3	604	5	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	2.50e-88	1	604	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.50e-88	1	604	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.42e-86	2	604	37	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.83e-86	1	604	10	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.30e-75	2	602	38	608	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000060

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_01361-RA-p1.