CAZyme Information: RL4_JR_01282-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_01282-RA-p1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		67310.84	10.0784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000169:3891870-3893801(+)

Full Sequence      

MFSSSGFIPPDAESVNPGTRNRRRPNAAAGSATGATANDRANGHGSSSLLGWNGSSSTSR
NGNGSSASSTSTGGTSRTVSGSNLLGSASGWSIPNWSSIQELASSLLSVPGDDAPPGSRG
HSTGGRLQDHKTRKNPDVWGPAPPGESSSGRPRLKDVAAGPTAAREAELRARKTASVLES
HPGVNGGLDVRGKYKRRNSDENLQAAARGDAAQEAEDCLVYIHHVKPVDTYFGIVLKYRC
REDAFRRANGLWNRDNIQVRKWVALPVDMCEIKGRPCDDPSLVSASVDPSRSTPTPTART
GAGTGDSSDYFGTATTKSTTSLADDAAEPPWTHVRWVRLESCPDPVEIARISRNALGFFP
PRRKKSLHSTVSTVSTPRQSLDGPANGSLSDRTAGMESPSRVSSRQSLAGGRMSLGAPSL
SSASPSSHTGSRSAAVKDTRPEWMRRPGGVGSMNRSVRAPGPARDPLNKWTTKHLPGLNI
ETLPSMSVMGSETAHFGFAKDGGEAPGLVESSFEAGRDDLTSSGRQDSSLDKAAASIETW
LRGAFAKRPGTPGGLNGSSMLLSSSSSSSYGGRPGRQLEEETIGDLIELEVGPYEDSRHS
GHGGFGSEHSSNTTPTNTTSGWRADGGGGSLPRGRSTKGKKAD

Enzyme Prediction     

No EC number prediction in RL4_JR_01282-RA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197609	LysM	0.002	222	259	1	38	Lysin motif.
212030	LysM	0.003	222	259	2	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	0.004	223	259	1	36	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC89347.1|CBM50	4.48e-144	91	643	94	637
QBZ56316.1|CBM50	2.62e-136	94	601	109	601
QKD49082.1|CBM50	2.19e-125	73	601	100	590
CZS77411.1|CBM50	6.31e-125	77	589	104	579
VBB83868.1|CBM50	6.31e-125	81	598	86	587

PDB Hits     

RL4_JR_01282-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CY38|Y2072_EMENI	5.59e-40	95	543	120	557	Uncharacterized protein AN12072 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN12072 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000005

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_01282-RA-p1.