CAZyme Information: RL4_JR_01192-RA-p1

Basic Information

• Species: Raffaelea lauricola
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Raffaelea; Raffaelea lauricola
• CAZyme ID: RL4_JR_01192-RA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	JACBXF010000169|CGC20	41341.60	4.5481

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_RlauricolaRL4	10461	N/A	146	10315

• Gene Location: location=JACBXF010000169:3642167-3643361(+)

Full Sequence      

MTRTSSLISRAAATFVLLAGFTGLAAADCECGYSADINGTNYFFTDLIESDFAHLSNITK
NKDWVRQQFNVTAASNRGSFGEVFAVDNIYTNPSSNASVQNGLASDGRPAGLVLAVKSSR
VDDMVPVAEIDSNRTDIIYGTFRAGIRVTDVPGTCSAFFWYFNDTQEIDMEFLSQEFNTT
NSSYPVNLVLQSREAAENGYDASRTSTFIKTYLPFNPTTDFHEYRMDFLPGRVVFYADNA
VLANMEGDAVPDHAGHLVLQHWSNGNPNWSGGPPTEDATTTVSYVKAYFNSTTTQRQNDW
LNRCPNINAAKGICAIPEVSATNNSASGWFFTSQHNMTNNQTVSGQGENAGTRHAPGTLL
WSVLATAFIISGWGLEIW

Enzyme Prediction     

No EC number prediction in RL4_JR_01192-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	105	288	1.4e-87	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.97e-41	51	288	2	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	4.03e-08	139	284	68	205	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	4.85e-07	128	241	23	124	Glycosyl hydrolases family 16.
185693	GH16_laminarinase_like	6.66e-06	90	288	33	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
178706	PLN03161	5.46e-05	150	270	82	196	Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62950.1|GH16_23	8.65e-130	16	377	32	395
VBB86764.1|GH16_23	5.42e-123	22	364	38	387
CDP32289.1|GH16_23	5.42e-123	22	364	38	387
AEO58087.1|GH16_23	9.23e-120	25	352	55	401
UQC77992.1|GH16_23	1.20e-118	24	373	18	369

PDB Hits     

RL4_JR_01192-RA-p1 has no PDB hit.

Swiss-Prot Hits     

RL4_JR_01192-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999763	CS pos: 27-28. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in RL4_JR_01192-RA-p1.