CAZyme Information: RHZ54246.1

Basic Information

• Species: Aspergillus thermomutatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus thermomutatus
• CAZyme ID: RHZ54246.1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	NKHU02000113|CGC1	58643.04	8.6635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AthermomutatusHMRAF39	9702	N/A	0	9702

• Gene Location: location=NKHU02000113:70519-72117(-)

Full Sequence      

MLDSRKFLIVVTAGGKTNASPIFEIAQILNTRGHKIEFATLDGQQDWAREYPFVSQVYVL
GPGQTSEAEEQAYLQMSRWKLGLRHSFEPIMETRKCLESSWGTVYPALSQLVQDPVSRPN
FILADYLVDAARDMQIEHDIPIAMHWPQMPTNMLPASYIPGATGLQIGVLTSEHATVWQR
LQNYLLAFRALPPYLRYRSWVRDLRARHGVRRPLVAKSKPDYLLLVNSFFGLEPARDLPP
NVAAIGPVLADTYPGLTPELESFVEHRKRILYISLGTHALLLDAILQRILHGALLALHDG
KAIDGVVWSIRGMALKQFNLAARVPGPHLAATANPLCIKDLVSGVDSIPILFAPFVPQRA
LLAHPKVSIFLTHAGASSTNEAAYHGVRTITIGIYFDQLTNAMKLRDAGVSIPLDRDTFT
PADLCRAIDALVADVSGTFAANCERVQRIARIASRRKWLAADLIEEALADSEGRRKLGGA
DARRGMHLQTADMRMPFWKVHNLDLWGIAAGCVVAGLGVLVCVSIALGIALT

Enzyme Prediction     

No EC number prediction in RHZ54246.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	124	453	2e-26	0.6989528795811518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	5.30e-40	9	466	4	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	8.10e-19	4	475	1	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	1.98e-16	154	515	163	476	UDP-glucoronosyl and UDP-glucosyl transferase.
215084	PLN00164	4.32e-09	357	437	348	434	glucosyltransferase; Provisional
223071	egt	5.15e-09	357	451	355	447	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86180.1|GT1	2.45e-168	1	507	1	507
QKD56593.1|GT1	3.32e-143	5	506	8	500
QKX59607.1|GT1	1.67e-135	4	508	9	507
CAK46937.1|GT1	3.24e-134	1	517	7	495
UPK98814.1|GT1	4.23e-132	5	506	9	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	3.28e-12	355	449	75	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
7CJX_A	4.77e-11	355	434	76	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	5.69e-11	355	449	97	189	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
6PNT_A	7.00e-07	355	434	324	401	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36512|UDB13_RABIT	3.14e-16	153	513	190	503	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|Q9GLD9|UDB33_MACMU	4.01e-15	153	513	188	501	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|Q9TSL6|UDB23_MACFA	1.24e-14	153	513	188	501	UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis OX=9541 GN=UGT2B23 PE=1 SV=1
sp|Q9R110|UD2A3_CAVPO	2.19e-14	111	517	149	506	UDP-glucuronosyltransferase 2A3 OS=Cavia porcellus OX=10141 GN=UGT2A3 PE=2 SV=1
sp|O97951|UDB18_MACFA	2.19e-14	153	513	188	501	UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis OX=9541 GN=UGT2B18 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

Start	End
505	527