CAZyme Information: RAK82120.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK82120.1
• CAZy Family: PL42
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	KZ824623|CGC3	75391.79	6.5590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824623:541606-543966(+)

Full Sequence      

MQSDDSSSNEDPTLTRSSWCALPAQLIYAGFSEPATDEQGRLTVAVAIRNATQLIDFFTH
HFHNAVEGTQIPCHAISELLSQLRAYGEKHQEKFIAVGLPEGLVQKCPGLCSRLWHDLDT
LPLVLKYKDHPRQPDEQGSLSIFASWKEKTADEQADSMARKCLRSFGVGHLIHNQIHYNG
MVDVDRSFCIRFAEAEGYQRTVSPELWTLVQGLAKDLVERKVKIAFFSMTCQGKPDVHTR
HALLRLGHVLGVDIRWYVPKPRPNILQLIRNMEDLMEGLAGPDVSLDTDDQLQIMEFAYE
NARRYWLEEHGPLRSRQQGGADVVVIDSAPLLTLALLAKQHDPHRPVVFENRLHAPPDVL
RQQSTHPQAIAWQFVQTKLEHVDTLVTTLPRELAPSVMSEANVGYISPSIDQLDGLNKHL
TDADMTFYGQELNSLCRTFGNPVVHYPREQYILSLSQLRPGDGTLALLDAYAAFCTIAWT
DDPKLPLPKLLICHHGPAQRSQSSPHHDRLFSHVQSKMKRFASRICIVQISPQDQVWNTL
LSNARVVVQLSLCQGIPEVLLWAMQKQKPVVTTAAGGSFFAAHEELKERMFLVEDGANKT
DTVAQHLYGLFSTEQSTGERATSGARQDLPERFTTVGNAACWLFLASCLSRETAFRLNGE
DIATLARQVGSTL

Enzyme Prediction     

No EC number prediction in RAK82120.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	4.13e-91	223	649	1	378	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
223515	RfaB	1.19e-04	442	634	192	362	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340831	GT4_PimA-like	1.72e-04	451	577	194	301	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
395425	Glycos_transf_1	6.24e-04	451	577	4	112	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340838	GT4_MtfB-like	6.31e-04	445	590	188	327	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98080.1|GT4	6.03e-224	18	668	12	652
CAK47237.1|GT4	1.80e-219	18	668	12	652
BCS10530.1|GT4	1.85e-219	18	668	12	669
QMW47856.1|GT4	2.67e-193	18	668	19	661
QMW35794.1|GT4	2.67e-193	18	668	19	661

PDB Hits     

RAK82120.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6YRN9|TREPH_PLEPU	5.44e-86	7	668	25	717	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|O75003|TREPH_GRIFR	6.71e-85	27	667	39	709	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|Q9UV63|TREPH_PLESA	3.91e-80	7	668	25	729	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RAK82120.1.