CAZyme Information: RAK82067.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK82067.1
• CAZy Family: GT41
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1100	KZ824623|CGC4	120367.45	4.8707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824623:393196-396650(-)

Full Sequence      

MPPNPGPPPPYRDHLKQDAPSRKSLSSFAPIPEEESSPSADIDDRFTLSDLSDDDDHHHN
HNTGGSGSSSRSSSSQIKLRRIDNHHSRHSSTASKPAYAYPASNNNSARPSDVEAYLSSI
TAAERELLTAAHQFELSDDDEEDSDDSDARSVSSDVGLRKGSKGHHRRRSSAFKKHTPHM
GWGWTTTTRYYYRKVWCRALLVVVLVLGALVWVFLRFAARGGWDAGRVEVDMPPSESWFP
TPQGGALEDWADDYRRAELLVRSMTLIEKINITTGVGWQMGMCVGNTAPAELVKFPSLCL
QDGPLGLRYADLISAFPAGVTTGATWNRELIRQRGVALGEEARTKGVNVLLGPSMGPLGM
MPAGGRNWEAFGADPVLQGVAAAETIRGIQSTGVMATAKHYIMNEQEHFRQPYEWGIATA
LSSNINDRALHEVFLWPFAEAIRADVASVMCSYQMVNNSHACENSKLLNGILKDELGFQG
FVQSDWLAQRSGINSALGGLDMSMPGDGLRWADGKSLWGSELTRAVLNTSVPMERLNDMV
TRIVAAWYHLGQDTWERPPPEGNGGPNFSSWTNDEVGWIYQGSPGDETYGVVNRFVNAQG
EGDNAHWIIARKVATEGIVLVKNDRQTLPLSRRPTTGSGAVFRVGVFGDDAGPAMGPNAC
ADRGCNQGTLAMGWGSGTAEFPYLVSPFEALQSAWETEIELSPYLRNAVMPAEVADKDLC
LVFANADSGEGFISAGGIHGDRNNLFLQKGGDTLIETVAQNCAGPTVVVVHAVGPVVVES
WIDLPGVDAVLFAHLPGQESGNALMDVLFGVVDASGRLPYTVGKSLEDYGPGAQVLYEPN
APVPQVDFQDGLYIDHRYFDRHNITPRFEFGFGLSYTTFELADLHVQGLQSKSRLPASRP
PQTVFPPEYDAEPPRNESVLFPAEFRAVPQFIYPYLTSMDGTAAANYTHYPEGYDQPQPL
SPAGGGLGGNPSLYDEVVNVEVEVRNTGPRAGQTVVQVYVSFPGGVTEDGDWVEVHEGAR
RSSKVKLERMPEPIEFPSRVLRNFTKVALEAGERQTVAMTLTRKDLSYWSVREQNWVMPD
GEFEIWVGQSSRDLPLRGEY

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	293	505	1.3e-56	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	5.43e-43	618	876	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.08e-42	314	651	81	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.94e-39	316	1093	120	756	beta-glucosidase BglX.
395747	Glyco_hydro_3	5.58e-28	316	543	88	313	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	1.15e-23	995	1091	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02242.1|GH3	0.0	10	1100	4	1045
BCS13924.1|GH3	0.0	10	1100	4	1045
CAK42292.1|GH3	0.0	210	1092	2	878
QMW37281.1|GH3	0.0	7	1100	2	1048
QMW25221.1|GH3	0.0	7	1100	2	1048

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJJ_A	2.44e-248	231	1097	3	835	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
4IIB_A	1.50e-246	235	1096	6	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJI_A	6.59e-246	235	1097	6	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5JU6_A	1.43e-242	215	1097	6	848	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6SZ6_A	6.37e-235	235	1096	4	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CMH6|BGLE_ASPCL	0.0	112	1100	102	1050	Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglE PE=3 SV=1
sp|B0YD91|BGLE_ASPFC	0.0	78	1100	67	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglE PE=3 SV=1
sp|Q2UTX5|BGLE_ASPOR	0.0	7	1100	2	1048	Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglE PE=3 SV=2
sp|Q4WD56|BGLE_ASPFU	0.0	78	1100	67	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglE PE=3 SV=1
sp|A1DLJ5|BGLE_NEOFI	0.0	113	1100	94	1045	Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
195	217