CAZyme Information: RAK81941.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK81941.1
• CAZy Family: GT34
• CAZyme Description: mannan endo-1,4-beta-mannosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	KZ824623|CGC3	41110.52	4.7150

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824623:66253-67514(-)

Full Sequence      

MKLSHMLLSLASLALATALPRTPNHNAATTAFPSTSGLHFTIDGKTGYFAGTNSYWIGFL
TNNDDVDLVMSQLAASDLKILRVWGFNDVNTKPTDGTVWYQLHANGTSTINTGADGLQRL
DYVVTSAEKYGVKLIINFVNEWTDYGGMQAYVTAYGAAAQTDFYTNTAIQAAYKNYIKAV
VSRYSSSAAIFAWELANEPRCQGCDTSVLYNWISDTSKYIKSLDSKHLVTIGDEGFGLDV
DSDGSYPYTYGEGLNFTKNLGISTIDFGTLHLYPDSWGTSYDWGNGWITAHAAACKAVGK
PCLLEEYGVTSNHCAVESPWQQTAGNATGISGDLYWQYGTTFSWGQSPNDGNTFYYNTSD
FTCLVTDHVAAINAQSK

Enzyme Prediction     

EC	3.2.1.78:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	64	338	6.2e-88	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	1.45e-26	49	336	4	276	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
395098	Cellulase	4.78e-11	74	312	26	241	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.18e-05	36	355	32	368	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAA67426.1|GH5_7|3.2.1.78	6.98e-286	1	377	1	377
QEX95509.1|GH5_7	1.51e-280	1	376	1	376
BCS17023.1|GH5_7	9.38e-206	1	374	1	385
BCS05469.1|GH5_7	9.38e-206	1	374	1	385
ABE73149.1|GH5_7|3.2.1.78	1.12e-205	26	374	13	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WH9_A	3.61e-201	32	374	2	344	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
3WFL_A	1.31e-179	32	372	3	342	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]
1QNO_A	7.76e-158	32	373	4	344	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
3ZIZ_A	3.70e-153	19	374	4	356	Chain A, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]
4AWE_A	7.89e-80	32	372	6	381	The Crystal Structure of Chrysonilia sitophila endo-beta-D-1,4- mannanase [Neurospora sitophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00012|MANA_ASPAC	1.24e-286	1	377	1	377	Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=manA PE=1 SV=1
sp|A2QKT4|MANA_ASPNC	1.29e-200	1	374	1	382	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=manA PE=1 SV=1
sp|B8NVK8|MANA_ASPFN	4.11e-200	1	376	1	386	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manA PE=3 SV=2
sp|Q2TXJ2|MANA_ASPOR	1.17e-199	1	375	1	385	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manA PE=3 SV=1
sp|A1D8Y6|MANA_NEOFI	5.70e-197	32	375	26	369	Probable mannan endo-1,4-beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=manA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000300	0.999671	CS pos: 18-19. Pr: 0.9455

TMHMM  Annotations     

There is no transmembrane helices in RAK81941.1.