CAZyme Information: RAK81877.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK81877.1
• CAZy Family: GT34
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	KZ824624|CGC5	85865.66	4.6846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824624:745500-748413(-)

Full Sequence      

MLLALGTLVVSGVAQARTATSASGSPPRDPPIVNPTRAPYQDPNLETVLRVEDLLSRMPM
REKMAQLMQGELDRFVDFDTGYVNETAMKDHMFYHSSMLRGSYPRSTLDLAYRGAQALQG
WIMNDTSLSLPAIVQCEGLHGLGLPNTTIFTSPIGLGASWNIELMERVAETIGKEARALG
ITQVFAPSLDLARDPRHGRVEESYSEDPYLAGEIGAAFVRGLWKSKVASTIKHLAGYGNP
EQGIYNGPVHGGPRELHTTYLPPFQRALQETGAFAVMSSYNSYDGIPSVSNRYLLTEVLR
EQWDFQYFTTSDYGGPDRLCETFKMCHSDPVDKEAVTMMVLPAGGDTEGGGSFNFDVVPD
LVSNGTLSPSIVDEAVRRVLRAKFDMGLFEDPFPAAPPSDWRALIRTPEALDLATEMDRE
SIVLLHNPGDILPLAQKSQKLAVIGPFADTLNYGDYIAYRPGGVTPRQGIQNLATKYGGE
IVYALGCEAWSNDESLIGEAVQQAQAADVAVVVVGTWTQDLEGQEKGLNATTGEGYDTND
LRLVGAQRALVQQIIDTGKPTVVVFSSGKPITEPWLSSNTTATALIQQFYPSPNGGVALA
DVLFGNHNPSGRLPVSFPRDVGSLPVAYDCLDSGREIRSPGARHANGSLEFGHDYVLDTP
DVWFGFGHGESYSTFEYSDIQVVPKAPRASDNVTVAVNVRNTSDRDGKEVVQLYVVDSLS
SVVTPNKQLKGFQKVFIRAGETATISLEVRVSSLGLWDAGMRYVVEPGEFIAHVGRSSTD
LRGNVSFFVV

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	124	337	9e-62	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.98e-135	51	782	38	758	beta-glucosidase BglX.
224389	BglX	8.85e-77	58	481	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	7.24e-61	1	749	6	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.26e-57	60	382	2	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	5.27e-46	422	632	1	204	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX60989.1|GH3	2.08e-285	39	789	27	777
CAP98759.1|GH3	1.86e-279	35	789	24	780
BAE62006.1|GH3|3.2.1.120	1.61e-277	40	789	29	778
QMW32562.1|GH3	2.28e-277	40	789	29	778
QMW44592.1|GH3	2.28e-277	40	789	29	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.41e-279	40	789	7	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.76e-278	40	789	7	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.62e-121	33	782	29	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.18e-103	51	780	7	724	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	6.30e-103	51	780	7	724	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33363|BGLX_ECOLI	2.12e-113	116	782	90	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	1.87e-109	51	782	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	8.09e-106	128	778	63	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|T2KMH9|PLH34_FORAG	4.88e-96	40	782	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	1.95e-80	128	781	35	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.045066	0.954899	CS pos: 16-17. Pr: 0.9063

TMHMM  Annotations     

There is no transmembrane helices in RAK81877.1.