CAZyme Information: RAK81869.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK81869.1
• CAZy Family: GT33
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		60196.05	6.0722

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824624:725346-727201(+)

Full Sequence      

MSNYNTDSTEGLRNAIFDFIIVGGGTAGLVVANRLTERSDVRVLILEAGTNRLDDPRTQI
PALGPTTYADQDFDWDLPTLPPEQLHDHCLFSTKGRTLGGSSVINQGLVVYPSQAGINTW
EQLGNPGWAHGQDGPLQVSFANQYIPVHAACWQGFRELGYPASADPIQGIGVGSFLAAGA
VDPATDTRSHAGAAYLSGPVQRRPNLRVVTGVHVDRLVLEQDRSTRTVRAMAVKVSHGKQ
TYHIRVNNEVILAAGAVQTPQLLELSGIGNGSLLRAHGINPTIEIPGVGENLQDHGIFSF
GYEVADGVSSDEMAHDPNAAAAAMAAYQQDGSGPLAMVPYICANMPCVDLPRAERASLLR
TIGESSGLGPKQAQVLQQLLEDPDEPTSQYTLLPFQLDPRQGVKSIKALMSPAHPGNFIT
LVSTLCYPLSRGSVHIRSANPRDHPALDHGILRHPVDLELHARHAMWMEKLAATPSMAAV
LKENGVRLHSPEPLTDLEQAKKDGGVVDPRLRVYGTTNIGVVDTSIFPLVPRGNIQATVF
AVAEKAADLIKEDFEGKPHGI

Enzyme Prediction     

No EC number prediction in RAK81869.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	129	485	1.1e-81	0.5880281690140845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.26e-76	17	551	6	532	choline dehydrogenase; Validated
225186	BetA	2.75e-72	17	553	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	6.50e-26	17	295	1	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.68e-23	428	546	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.44e-21	2	539	41	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27275.1|AA3_2	1.49e-218	1	553	1	616
QGA17771.1|AA3_2	2.37e-155	1	553	1	611
CAK40027.1|AA3_2	2.78e-155	16	553	14	612
BCS13057.1|AA3_2	4.15e-152	16	553	15	613
BCS01313.1|AA3_2	4.15e-152	16	553	15	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.30e-51	17	553	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.05e-48	12	553	1	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	1.32e-43	17	557	36	645	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
3Q9T_A	1.34e-42	17	553	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.34e-42	17	553	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	6.36e-72	17	553	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.36e-72	17	553	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.31e-68	10	553	7	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	9.45e-63	18	553	41	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	8.40e-49	1	550	27	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998009	0.002023

TMHMM  Annotations     

There is no transmembrane helices in RAK81869.1.