CAZyme Information: RAK81566.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK81566.1
• CAZy Family: GT31
• CAZyme Description: SGNH hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253	KZ824625|CGC6	26254.36	4.0304

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824625:674154-675093(+)

Full Sequence      

MMISRTLALLASVAPALATKPAAFYLAGDSTTAAQSSGGGGWGVGFLATLTDGAIGTDLG
YNGDTTASFVAGGAWANVIDAVTRSKVSYQPYVTIQFGHNDQKNTSGVTLEDYATNLQTM
AEAVVTAGGIPILVTPISRRTFNSTTGTVIEDLATQRNITISVAESIAVDYIDLNEASTV
YLDAIGATDAASYNRISTDYTHLNPVGSVVFGNMVSWLLLTTTSLAGNLADYTVPNAEIV
AAIANGTYIYPEV

Enzyme Prediction     

No EC number prediction in RAK81566.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	24	215	4.5e-39	0.9714285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238859	Rhamnogalacturan_acetylesterase_like	1.09e-49	24	215	3	194	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
404371	Lipase_GDSL_2	2.69e-08	28	207	3	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
225353	TesA	2.74e-08	18	215	5	204	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238876	Isoamyl_acetate_hydrolase_like	1.49e-06	60	211	39	192	Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
238141	SGNH_hydrolase	6.61e-06	28	215	5	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA09272.1|CE12	1.85e-79	15	252	20	261
CCD34352.1|CE12	7.21e-79	15	252	20	260
ATZ50485.1|CE12	7.21e-79	15	252	20	260
QSZ36344.1|CE12	5.48e-78	12	252	17	258
QKX59609.1|CE12	6.21e-69	20	253	34	270

PDB Hits     

RAK81566.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31523|RHGT1_BACSU	4.78e-09	20	216	4	209	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000538	0.999456	CS pos: 18-19. Pr: 0.9755

TMHMM  Annotations     

There is no transmembrane helices in RAK81566.1.