CAZyme Information: RAK81033.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK81033.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285	KZ824626|CGC8	29950.41	5.8003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824626:9804-10661(-)

Full Sequence      

MVSFTKALLIASSVASTALAMPSHIHANRHTGANHPHVTLEQRSINSTSGKRGAAYNSAS
TVTTLAHSGTVTWGYDWNMYSDGSLPSHVEYVPMLWGSKMFGTWFTAIETALNSGSKYIL
GFNEPDNSGQAAMSSSAAVSAYQKYITPFKGKAKLVTPAVTNGVGADTGLAWAENFLSGC
GGSCGVSVLAVHWYGDSAADFKTFVGKAVALADKYDLDETWVTEFALNSAVGAGQGTQEA
ASFLEEVVPWLDGQSGVGRYAYFMCAEGYLLNGDGLSASGQAYIA

Enzyme Prediction     

No EC number prediction in RAK81033.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	66	283	9.2e-64	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.35e-71	55	283	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK45900.1|GH128	1.56e-113	1	285	1	283
ACK11743.1|GH128	4.46e-113	1	285	1	283
BCS15933.1|GH128	4.46e-113	1	285	1	283
BCS04345.1|GH128	4.46e-113	1	285	1	283
BAE57006.1|GH128	3.93e-112	1	283	1	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	4.34e-61	49	283	2	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	1.11e-60	49	283	33	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UAX_A	2.70e-17	51	285	95	344	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	8.28e-16	51	285	25	261	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	2.14e-15	51	285	25	261	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

RAK81033.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000810	0.999172	CS pos: 20-21. Pr: 0.9647

TMHMM  Annotations     

There is no transmembrane helices in RAK81033.1.