CAZyme Information: RAK80941.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK80941.1
• CAZy Family: GT2
• CAZyme Description: SUN-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		44378.55	4.5588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824627:508601-510019(+)

Full Sequence      

MKLNAVAVSLATASLVAAQHHHQHRHHHKRNPESEVVTVAGPTVVTYVLDGKTITLEEVC
KGIADKTLTWASGQDIPDVCNGASSSSTTAASTSTSTTAAPALSSVAEFVEVAVAKATSS
SSSWSSSSSAHSSTAAASSSASSSSASSSSSSTATGLDADFPDGELDCDTFPSDYGAIAL
DYLGLGGWSGIQYVTISGSVVTEITTGVSGDSCTNGAMCSYACPAGYQKSQWPSTQGSTG
QSVGGIQCKNGKLYLTNTSLSKKLCIEGTGGVHVQNTLGESVAVCRTDYPGTESETIPLH
LGDNTLQPLTCPDGETYYKWEGKVTSAQYYVNPKGVSTEKGCQWGNGSEAIGNWAPINLG
VGVNDGKWLSIFQNSPTTTEKLDYNVKIEGDNLSGSCKYEDGVFYSESGTNDSGCTVEVV
SGSATYVFY

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	121	429	1.1e-107	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.93e-134	163	416	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR94847.1|GH132	8.91e-194	1	429	1	425
BCS07426.1|GH132	8.91e-194	1	429	1	425
BAE55477.1|GH132	1.64e-184	1	429	1	415
QMW38532.1|GH132	1.70e-184	1	429	1	416
CAK39361.1|GH132	3.47e-184	1	421	1	417

PDB Hits     

RAK80941.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	1.66e-179	1	429	1	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	7.39e-124	30	428	37	446	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|O43015|YBOH_SCHPO	2.37e-83	158	429	56	319	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|Q9UR09|PSU1_SCHPO	4.08e-83	161	429	162	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	1.26e-82	160	429	105	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999712	CS pos: 18-19. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in RAK80941.1.