CAZyme Information: RAK80783.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK80783.1
• CAZy Family: PL4
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		46139.90	5.7686

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824627:78496-80352(-)

Full Sequence      

MRFAPILLLIFLRVWPVAATILQNGQPREDPYPGQQSPIKLDDSWRNYDAGVPEIAYKGR
WDSQHISWWSAPGIKVEFSGSKLALSFGPSTSNGALVAYRIGSLDWRFSNVTADATYQFI
GPDDFTDGIDTKSNVFEMRVTNWGIGVQLAGVSVAKDAYITKPTPYKRKVEIIGGSLAGG
QYATYETLSSWSFLYGVGLGDAEFTITAYPGVCLADMQCYGGGVHGMTWWWNRASDPGAR
AHQFYGDNPPAFDNSAEQPADLVFIQMGGNDWRHPNEVPGDKFYQAYVDMVEEIHRVWPK
AEIVLMSQWGPFQKVGTEYKSTIQYKDEIIRVYEYFKDLRWTFVHYLNTDGILQHNDINP
KNHPTDVGHIKVASHLLQWTRLVLRWELKPTGEVQHGTLYWNDQEGY

Enzyme Prediction     

No EC number prediction in RAK80783.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	7.70e-45	169	381	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	8.02e-15	192	378	7	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	6.45e-12	192	369	5	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	1.42e-04	253	376	73	224	GDSL-like Lipase/Acylhydrolase.
238872	SGNH_hydrolase_like_2	5.50e-04	258	378	60	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK40140.1|CE0	4.56e-205	15	407	15	407
BCS23119.1|CE0	6.96e-205	7	407	6	409
ABF50860.1|CE0|3.1.1.-	1.09e-204	18	407	17	402
EAA63262.1|CE0	4.52e-192	18	407	17	392
QMW34907.1|CE0	4.55e-155	18	407	15	398

PDB Hits     

RAK80783.1 has no PDB hit.

Swiss-Prot Hits     

RAK80783.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999789	CS pos: 19-20. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in RAK80783.1.