CAZyme Information: RAK80287.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK80287.1
• CAZy Family: GH92
• CAZyme Description: rhamnosidase B precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595		63693.08	6.1244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824630:695984-697985(+)

Full Sequence      

MHIITPLLIPAVLVAAARVPYREYILAPSSRVIVPASVRQVNGSVTNAAGLTGSSLGTAV
FHGVSSVTYDFGKNVAGIVSLTVGSSSSPSAFLGVTFSESSLWASSEACDATGNSGLDAP
LWFPVGQKAGTYTPDSKYVRGGFRYLTVVSNTSATIPLNSLHITFTAAPDQDLQAYQGWF
HSNDELLNEIWYAGAYTNQLCTIDPTYGSASSETISTSGLNYWYNNLTIANGTSTVTDGA
KRDRAVWPGDMSISLESIAVSTNDLYSVRMGLEALLALQSSEGQLPWGGKPFNIDVSYTY
HLHSLIGMSFLYRFSGDKVWLSNYWGQYSKGVEWAVRSYTNWASVADGVKSAANQLLWDD
QAGLYRDNQTTELHPQDGNAWAVKSNLTLSGSQNRAISQALKARWGRYGAPAPEAGATIS
PFIGGFEIQSHFLANQPDVALDLIRLQWGFMLRDPQITQSTFIEGYSTDGSIHYAPYAND
ARISHAHGWSTGPTYALTAYTAGLQLLGPAGNSWLIAPQPGGLTSIDCGFATALGVFSVV
FERDSVGRYNSFSFGAPTGTTGRIELPGVRGTLVSTTGQRVQLVNGTASGLREGK

Enzyme Prediction     

EC	3.2.1.174:2	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	66	337	2.2e-37	0.4623015873015873
GH78	340	566	1.7e-35	0.4166666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	0.009	503	574	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAG13964.1|GH78|3.2.1.40	0.0	1	595	1	589
CAP79677.1|GH78	2.77e-276	1	594	1	651
BAU37009.1|GH78	2.77e-276	1	594	1	651
BCR95812.1|GH78	4.72e-274	8	595	6	650
BCS08346.1|GH78	4.72e-274	8	595	6	650

PDB Hits     

RAK80287.1 has no PDB hit.

Swiss-Prot Hits     

RAK80287.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.631437	0.368566

TMHMM  Annotations     

There is no transmembrane helices in RAK80287.1.