CAZyme Information: RAK80284.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK80284.1
• CAZy Family: GH92
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	KZ824630|CGC8	34378.04	4.5797

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824630:691293-692395(+)

Full Sequence      

MHFSSALVALIGLTAPVLSAPASSLEKRTSRTSAPSGCLSVGSGQTYSTISAALTALGSS
TAAACIYIASGTYSEQLTIKYAGALTLYGQTSDTGSYKNNAVTITHTISSPDAGSLDKSA
TVNVVSDNFKMYNINVANGYGKGAQAVALVGNADQLGFYGCQFTGYQDTLYVKAGTQYYS
NCLIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSTDDGWYAFDNCNIKAASGVS
LTDSVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMAEGATPLYYEYNNSGDGSSTSSRL
YESSISAAVTKTTVLGSTWGDWIDRTY

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	44	304	4.8e-81	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	5.88e-56	42	324	8	296	Pectinesterase.
178372	PLN02773	1.40e-44	33	300	1	276	pectinesterase
178037	PLN02416	3.16e-44	35	300	228	502	probable pectinesterase/pectinesterase inhibitor
215357	PLN02665	4.00e-44	42	319	76	359	pectinesterase family protein
215173	PLN02304	3.37e-43	35	319	81	373	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALI87001.1|CE8|3.1.1.11	7.38e-224	1	327	1	327
EHA20167.1|CE8	3.45e-190	1	327	1	327
CAK47976.1|CE8	3.30e-188	1	327	1	327
BCS09280.1|CE8	7.74e-187	1	327	1	327
BCR96791.1|CE8	7.74e-187	1	327	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.35e-185	30	327	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	4.35e-185	30	327	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	5.31e-27	112	323	79	302	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	5.02e-26	66	300	35	275	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.11e-14	44	322	15	337	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QK82|PMEA_ASPNC	5.86e-189	1	327	1	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.77e-156	1	327	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	4.07e-156	8	327	7	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.05e-153	1	327	1	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.05e-153	1	327	1	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000255	0.999733	CS pos: 28-29. Pr: 0.5958

TMHMM  Annotations     

There is no transmembrane helices in RAK80284.1.