CAZyme Information: RAK80240.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK80240.1
• CAZy Family: GH79
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839	KZ824630|CGC6	93856.64	7.8189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824630:591190-594147(+)

Full Sequence      

MVEQYTDDVSGNPFVKDTDVPSRENSPAPPVSPSPSNVQETSFSTGWQQRQTIGASRLRR
YPTRKINLVKGTVLSVDYPVPSAIQNAVEPQYSNDASISPEEFTHLRYTAATCDPDEFTL
RNGYNLRPAMYNRHTELLIAITYYNEDKVLTARTLHGVMQNIRDIVNLKKSQFWNKGGPA
WQKIVVCLVFDGVGACDKDTLDVLATIGIYQDGIMKRDVDGRETVAHIFEYTTQLSVTPA
QELVRPRIDDDQAHNLPPVQMIFCLKQQNSKKINSHRWLFNAFGRILNPEVCILIDAGTK
PGHKSLLALWEAFYNDRNLGGACGEIHALLGQQWEKLLNPLVAAQNFEYKISNILDKPLE
SVFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGDHTLSAKLGPKGIEGMNIFKKNMFLAED
RILCFELVAKAGFNWHLTYVKASKGETDVPEAPAEFLSQRRRWLNGSFAAGLYSIMHFTR
IYKSSHNALRLAWLHVQLLYNLCQLVMTWFSLASYWLTTSVIMDIVGVPSSTNKNRGWPF
GNEVTPIVNNVIKATYVMFLIQQYVLALGNRPKGSKMAYLLALVYFAIVQVYILVLSFYL
VAQAFAGGSLDIDVDHGAGGFLSSFFTSTSGLVLIALVSTYGIYVLASILYADPWHMITS
SWAYFLGMPSSINVLMVYAFCNWHDVSWGTKGSDQSSALPSAQTHHSSATADDPSSATNF
VVEADKPQADIDTEFELTVKRALTPYQPPVEHGKTELSDSYKTFRTNLVLLWSLSNALLV
LLINNASVTNLCLTSTSTIRTAWYFKIILLTTSALSVFRFLGALWFLGKTGLLCCFARH

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	143	313	9e-71	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.09e-98	143	313	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	9.31e-90	139	470	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.09e-31	65	142	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	7.59e-22	262	603	115	410	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	3.50e-17	279	689	187	490	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS00643.1|GT2	0.0	33	839	75	871
CAK38392.1|GT2	0.0	29	839	71	873
QRD88403.1|GT2	0.0	37	839	110	903
BCS28982.1|GT2	0.0	31	839	92	890
EAA60528.1|GT2	0.0	54	839	106	905

PDB Hits     

RAK80240.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92197|CHSC_ASPFU	0.0	47	839	108	893	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	27	795	99	864	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P29070|CHS1_NEUCR	0.0	47	839	126	917	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|Q00757|CHSB_EMENI	0.0	34	839	115	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	0.0	34	839	111	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

Start	End
506	528
579	601
629	651
658	680
769	791
804	826