CAZyme Information: RAK79391.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK79391.1
• CAZy Family: GH7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		52111.45	8.1893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824633:272204-273683(-)

Full Sequence      

MALLRSHRWRLRQSHLLQTIYLMGLFSVIGIVLIWYGVNSDREYIHPLLTQLIPAGHCAC
LTSTTFQCASCLKCAPKKPLPPTALPAVSAWKFEAGRDSGNEGLSRAQCMAAFPGLFEDI
LRAGTFWRTHGGLDVEHLEYIPLKHGMARAFIHRGELYVVNALSRGEDHRRKILAVLSAI
HRALITNPERAIQQDLEFVFSVEDKVTDVTTDDQPIWAFARSAGEEANVQNSIGPYDQVV
DHIKCTEIPWSQKKRQLVWRGKPSFAPKLRRALMDAARGQPWGDVKHVDWNQRTNVMSLE
DHCRYMFIAHVEGRSYSASLKYRQACNSVVVAHKLQYIQHHHYLLLSEGPSQNYIEVDRS
FSDLAAKLEPLLDDPSRAERIASNSVQTFRDRYLTKAAEACYWRMLFEGYSDVWNSSVPG
QSRYQEQQRGFRYESFILLDSRMMFEFDATSATGAMG

Enzyme Prediction     

No EC number prediction in RAK79391.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	195	412	1.2e-17	0.968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.53e-15	195	411	4	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	8.79e-15	215	411	124	320	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06430.1|GT0	8.48e-235	1	449	1	460
BCR93809.1|GT0	8.48e-235	1	449	1	460
QMW31614.1|GT0	3.10e-230	1	456	1	464
UDD60541.1|GT0	3.10e-230	1	456	1	464
QRD90629.1|GT0	1.65e-228	1	456	112	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	3.82e-07	198	410	156	375	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T045|RUMI_DROME	2.01e-06	198	410	168	387	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	6.18e-06	215	410	180	385	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000002

TMHMM  Annotations     

Start	End
20	39