CAZyme Information: RAK79065.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK79065.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		37000.71	4.6268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824634:87184-88221(+)

Full Sequence      

SALAVESHVSAQLSQLASVPPIPLPTTIDNYKTWTQVASLMPPLQTNNVKADTMEMVAAV
RDAIKTESDSGATIQSLAGRDAALRVMIVGDSMTQGQEGDYTWRYRIWEWFASQGEAVDF
VGPYTGTVQPDSPSAPALPPLYGSKAVPGQPKTSGGYAAGVPSSFDRDHFAVWGRAAAVD
KGLIYDVLSAHSAELMLLMLGFNDMGWFYSDAAGTLDSIHTLVTNARAVNPNLKFAIANV
PQRSFIGGRDDLPISTNIYNALLRNAIPTWSTADLPIHLVELQENYDCEPSGCPAGYDGL
HPTATGEFQIARAFSLTLVNDFKIGSSPLSIPGSIPGRSLPVPTNF

Enzyme Prediction     

No EC number prediction in RAK79065.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	84	315	3.2e-49	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.99e-37	166	318	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	8.30e-05	185	306	54	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	8.21e-144	1	346	59	395
BAE63679.1|CE0	6.16e-130	54	345	29	317
BAE60780.1|CE0	4.51e-106	134	346	16	229
SCG40251.1|CE0	7.07e-93	76	345	328	597
UKZ09962.1|CE0	2.68e-91	82	343	510	773

PDB Hits     

RAK79065.1 has no PDB hit.

Swiss-Prot Hits     

RAK79065.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RAK79065.1.