CAZyme Information: RAK78837.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK78837.1
• CAZy Family: GH43|GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	KZ824635|CGC5	42564.13	7.7616

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824635:166134-167484(+)

Full Sequence      

MTLKNGADRKEPDHKSRTQNLYAILNYNWAIFPCTATILFLGLYEISIWTGAYHEVVVPD
ARWTPDCTVLAMILGPFLLFQLPPYYTLWGLCLPIRPFAYAKASKKRPFRSLKVCLVTKA
TNVQTVIHTAQHWNRLSKRDRISFHVVVDSVPNPFVGMLPDFVELLEVPSSFRPDHARHK
ARVLEWCRRHWRLSEQDWVLHLDEETEITEEALSACVDFIERGAEDIGMGTIFYNAHNHW
KNPLLTVAEALRVAEDFGRFQLPVRLFQRPLLGWMHGSFILINGQAENAVTWDTNCLAED
FWFAYHAAKQGFKTGWIHAVAREQPPESLQDLVRQRRRWYSGIMSVPDWSVRLALAIPML
ESFVHLGL

Enzyme Prediction     

No EC number prediction in RAK78837.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	198	353	3.9e-24	0.7614213197969543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	3.22e-20	198	368	1	164	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	7.15e-07	68	346	5	287	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133049	CESA_like_2	4.19e-04	292	344	179	231	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133033	Chitin_synth_C	5.01e-04	297	339	192	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
404520	Glyco_tranf_2_3	0.001	196	342	88	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25143.1|GT2	1.08e-128	1	360	1	355
BCS04949.1|GT2	2.01e-100	18	355	29	343
BCS16511.1|GT2	3.18e-92	18	355	29	326
CAE7032892.1|GT2	2.35e-63	14	367	3	358
QRC91692.1|GT2	7.11e-61	71	348	57	333

PDB Hits     

RAK78837.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8XAC4|BRE3_CAEBR	6.39e-28	144	344	130	331	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis briggsae OX=6238 GN=bre-3 PE=3 SV=1
sp|Q03562|BRE3_CAEEL	3.09e-27	144	344	130	331	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis elegans OX=6239 GN=bre-3 PE=2 SV=2
sp|O01346|EGH_DROME	4.31e-27	168	346	151	333	Beta-1,4-mannosyltransferase egh OS=Drosophila melanogaster OX=7227 GN=egh PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999969	0.000005

TMHMM  Annotations     

Start	End
21	43