CAZyme Information: RAK78836.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK78836.1
• CAZy Family: GH43|CBM91
• CAZyme Description: nucleotide-diphospho-sugar transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		38638.15	5.1812

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824635:164303-165301(-)

Full Sequence      

MKHLVSIPILLVGIALLSSWWSSGILPWQRANDRAASSTQRTIYAAYLNPPTEFQDFWFS
RYKNSSDPYFDAVRILAYQILHAPETRTKLNLDFVVFVHEGVDESKRDCLRRDGAQVIEL
PELKADWTRFKDARWAHVLTRLRLWQMVQYDRILLLDADSVLTRSIDAVWNLPELQPRTP
LSTSVHVGEMVLPLPESYVLAGLPQLRLNHTARPARVPEDFYDWETLNVGFLMLQPSLEI
FDYFAAMLAVPESFESSIADQSLVNVVFAADGPMPWTRLDLSWNVQWPWPDDLWAGYAVL
HDKWWAPLHPETLDFFHSWYWRMIGFYSVRDG

Enzyme Prediction     

No EC number prediction in RAK78836.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	66	301	4.4e-26	0.7704280155642024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.45e-21	65	322	8	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.02e-19	56	307	70	338	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133064	GT8_GNT1	4.32e-06	132	192	74	136	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	9.07e-06	116	286	63	214	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
279798	Glyco_transf_8	3.32e-05	137	289	85	221	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR42298.1|GT8	1.49e-64	36	331	60	351
SMY19627.1|GT8	1.49e-64	36	331	60	351
SMR44472.1|GT8	1.49e-64	36	331	60	351
SMQ45949.1|GT8	1.49e-64	36	331	60	351
QRD03274.1|GT8	1.03e-55	39	331	130	422

PDB Hits     

RAK78836.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09680|YA0C_SCHPO	5.10e-22	59	330	75	369	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43062|YGT9_SCHPO	2.60e-21	67	305	89	345	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|O43061|MU136_SCHPO	5.86e-16	63	307	76	338	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q9LSB1|GUX1_ARATH	5.67e-06	93	192	353	451	UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GUX1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.781773	0.218232

TMHMM  Annotations     

Start	End
4	26