CAZyme Information: RAK78804.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK78804.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
923	KZ824635|CGC4	102861.18	5.4737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824635:80074-82845(+)

Full Sequence      

MAEIFALAFEHSPSGFGIQHDAPRLSWKATCSNKSIRNWVQTAYEIALKAPECHPEDEGQ
IYRVDSPESTWVPWPGPPLRSRERKLIRVRAHGTWTETRGDHGPEAKEHAGCTAWSTWSR
VECALLSQQDWAAVPMVHPAIGGEQTLRPVVFRKTFELPADFGAVEQARLYVTALGMYRV
YLNGKRVGDDELAPGWTSYHHRMAYRAHDVSAGIAARNVLGVEVAEGWYAGRLGFNGGRR
CLYGDQIGALVQLEIVGARKDHLLQVMSDSSWKCNFSPLVRSEIYDGELYDMREELGDWH
GDPDYQEMTTTTTTAAAAWKPVVTLALPEASLVVPRAPAVRVTQQVTARRLFTTPSGRLI
LDFGQNLVGKLHVRELGLPANAEVKFTHAEVLENGELGIRPLRQAKCTDVIISSGETLRD
WSPKFTFHGFRFVQVDGWDPLSSSLSWQENITALILHTDFAPTGDFECSNDAINQLHRNA
RWSMRGNFVSIPTDCPQRDERLGWTGDIQVFSPSATFLYNCEGMLADWMEDVAAEQHDDG
GVPPLVVPNVLQHVWPPMPQAVWDDVVIILPWNLYQASGDVEILRRQYPSMKAWLDQGVH
RGNDGLWDPDHWQLGDWLDPQAPSDEPGDGRTSGVLVADAYLVRVTRTLAQISRLLGYEA
DYIHYQQASDRHLQAFHAKYVTPSGLVAGDSQTAYALVIVFGLVDSETQRTTISHQLSRL
VRMAKFRVATGFAGTPIILQALSDSNNLSLAYRMLLEDKCPSWLYPIMQGATTIWERWDS
LLPDGSINPGEMTSFNHYALGSVVQWLHETVGGLVPREPGWKTVLVSPQPGGPLTHAAVS
HDCPYGRWFCRWELSPSEDDDCVKVLAVELDVPLNATAIVRLGSETGEQMVGSGHYRFQV
PFVPQPYPPEAIAPFITNPGQGL

Enzyme Prediction     

EC	3.2.1.40:1	3.2.1.40:8	3.1.1.73:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	352	882	2.6e-159	0.996031746031746
CBM67	148	305	1.8e-24	0.8068181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.98e-150	463	811	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	1.86e-56	163	344	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	5.03e-27	353	457	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.31e-14	813	897	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33495.1|GH78	0.0	1	923	1	915
QRD94839.1|GH78	0.0	1	923	1	915
CAP83098.1|GH78	0.0	10	919	12	915
BCS09327.1|GH78	0.0	10	919	13	916
BCR96839.1|GH78	0.0	10	919	13	916

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	3.47e-240	4	900	4	865	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	6.58e-138	81	900	246	1030	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.15e-112	5	882	33	898	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KNB2|PLH20_FORAG	9.97e-140	12	890	46	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
sp|Q82PP4|RHA78_STRAW	2.51e-137	81	900	246	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|P9WF03|RHA78_ALTSL	5.85e-128	17	878	45	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|T2KPL4|PLH28_FORAG	5.33e-70	18	894	46	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RAK78804.1.