CAZyme Information: RAK78118.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK78118.1
• CAZy Family: GH3
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
703	KZ824639|CGC3	79013.26	9.4262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824639:573018-575351(+)

Full Sequence      

MPPSSTRVSVVEDVVIPAHLLASTTPSNHLWNSSHCDRSKQGPIQQAIQTAAFERECGRL
RRSATISGHQPPKIRTIANTRRLSEPLSISELSSITEIQSPCFSPRPDFDARAEGAPSNS
VPGTRDGAWPLPPRPQSYRISRIETGTRPRTARQAARHSIYDIYQKAKERRAALQRKYWA
QVLFEYAVYFLLIAFIYLVLVGIPLWKGAVWWLYYVVRFEFVIQGGWAITIGVAFFYAFG
PLLVSFEKDPPAAPEKLEGPNLEHNRKTAQATALLVPCYKSANIIGPTLEAALRIFPPQN
IFVIANGNAPEPLDNTEEVCRPYGVNHLWCPVGSKIIAQFVGCYAAKHFPNVLLIDDDCA
LPANFPVVSDRLKGRVQCIGYTIKSVGPGSSRGAFCQQAQDLEYKISGLQRAFAGVLGSA
TFPHGAISLWRTDFLKQTFHDHPGFSVSEDWFFGDSCRRLGGRITMCSAVFVETETPSAV
FFSSGGSRGGFGEMTIFKQRFMRWNFFFVNGMYFNMKYILCNWNLGWWELGAKVFVFQEV
YETLLYLVAPFMLPISFAVRPAFCGIMLGATNGLYFLNVVLFNLIHLRKKKESVSWTCLL
VYYMPYKIVLFLINVASCYWSLFKYARYFANRHPKVIEDDKAVEVVLRLEETTSLPSEET
KILPGLGRSFSITKVRARRPTNASQQPSVSIRASLVGVDGNWI

Enzyme Prediction     

No EC number prediction in RAK78118.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	272	480	3.7e-24	0.9260869565217391

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	1.38e-29	272	478	4	215	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	2.98e-08	274	450	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	5.67e-06	352	559	2	187	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44102.1|GT2	0.0	7	703	7	712
BCR93365.1|GT2	0.0	7	703	7	714
BCS06011.1|GT2	0.0	7	703	7	714
QKX60961.1|GT2	2.92e-287	9	684	9	692
UPL00273.1|GT2	8.70e-262	107	688	118	690

PDB Hits     

RAK78118.1 has no PDB hit.

Swiss-Prot Hits     

RAK78118.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
184	206
221	243
504	526
536	558
563	585
600	622