CAZyme Information: RAK78104.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK78104.1
• CAZy Family: GH3
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		66446.30	4.9003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824639:545830-547716(+)

Full Sequence      

MTAAKSYDYVVVGAGTSGLVLASRLTEDADVNVLLIEAGANRMGDPRIETPGFLSTLYGN
PDFDWDYMSEPQVHVNNRQIAQPRGRVVGGTSAMNFSVVMYPSESNFAAWKSLGNEGWGP
EDMAPYLRKFHTYTPPSEATSTLLSLERYMSPENQGTSGPVPITLPDVYGPFNQAWDEAF
ARLGWRTDADPIAGRKIGAFTAPLTVDGKTGQRGYAAAYYSPEVAQRPNLDLLTDTMVER
VLLTEVEGEVVATGVQVRAKDGERQDIRAAREVILCAGSLNTPQLLELSGIGQRELLEKH
DIPVILDRPGVGENLQDHCLASINFEVADDQVSGDIMRDPNVVQSLIQLYEQTRGGPLSG
MPISMAYLPLVDHDGQLSREKVHELLDQHLSQQAADLPPALQKQFALQRELLQAGHNASS
QYMLMPIQTHMLPGATTLADVLAKSLPGNYLTVMVLHNHPFSRGSVHIRSGNVEDKPVFD
PNYLSHPLDLEILARHVQFLDQIVATEPLASMLKPQSRIPQGVVDYSDLEKTKEVVKERL
YTCFHPAGTCAMMPAELGGVVDSQLKVHGTRNLRVVDASIFPLEPAGNIQATVYAVAERA
ADLIRAH

Enzyme Prediction     

No EC number prediction in RAK78104.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	606	4e-182	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.70e-108	2	605	1	532	choline dehydrogenase; Validated
225186	BetA	8.37e-106	1	607	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.17e-40	460	600	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.51e-34	75	318	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.05e-33	6	593	55	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96255.1|AA3_2	0.0	1	605	1	606
BCR96633.1|AA3_2	0.0	1	605	1	606
UDD56791.1|AA3_2	3.49e-302	5	606	6	608
QMW28733.1|AA3_2	2.85e-301	5	606	6	608
QRD83267.1|AA3_2	2.85e-301	5	606	6	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.71e-78	6	605	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.32e-76	5	605	4	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	5.96e-70	7	606	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.69e-69	7	606	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	1.04e-58	7	604	36	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.52e-105	7	605	14	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.52e-105	7	605	14	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.44e-103	5	606	12	618	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.31e-82	6	605	39	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.34e-79	5	604	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999687	0.000361

TMHMM  Annotations     

There is no transmembrane helices in RAK78104.1.