CAZyme Information: RAK77666.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK77666.1
• CAZy Family: GH28
• CAZyme Description: cutinase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305		29878.12	5.6036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824641:309390-310429(+)

Full Sequence      

MKSFVTLSLLATALAAPTPTLHGRQFDLSSLLSGSSSGSSTSSGSSGLSALASLFPTSGS
ATGSTTGSSDTSGSASGSTTGTTTTSTDSSSGLSALSSLFPSSSATTSSSGSSDGLSGMI
SSVMGGSSTQNGVTSNTGCKELTFIFARGTTEMGNMGSVVGPEVASALQSLTGNKVTVQG
VDYPADWAGNMNMGASGGPKMASLVKQALSQCPNTKVVLGGYSQGSMVVHNAASSLSAGQ
IQAAVLFGDPLKMTSVGKLDSSKVKEFCAVGDPVCENGVNVMAHLSYGSDAQTAAQFLVS
AVGLS

Enzyme Prediction     

No EC number prediction in RAK77666.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	139	301	1.8e-46	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.13e-50	139	302	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96605.1|CE5	1.07e-96	1	305	1	290
BCS09111.1|CE5	1.07e-96	1	305	1	290
CAK96288.1|CE5	1.58e-95	1	305	1	287
AKA62190.1|CE5	2.65e-94	1	305	1	288
BAE58644.1|CE5	8.52e-89	130	304	36	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	2.40e-40	134	302	74	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	1.42e-25	139	303	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3DCN_A	2.25e-24	128	303	10	201	Glomerella cingulata apo cutinase [Colletotrichum gloeosporioides],3DD5_A Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_B Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_C Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_D Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_E Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_F Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_G Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_H Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DEA_A Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides],3DEA_B Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides]
3QPD_A	3.12e-24	139	300	12	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
7CY3_A	5.28e-24	130	303	10	194	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	1.65e-84	128	304	49	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|A8QPD8|CUTI1_TRIHA	9.69e-41	134	298	74	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	2.04e-40	139	303	31	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|A0A024SC78|CUTI1_HYPJR	1.05e-39	134	302	74	247	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	1.05e-39	134	302	74	247	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000297	0.999685	CS pos: 24-25. Pr: 0.8864

TMHMM  Annotations     

There is no transmembrane helices in RAK77666.1.