CAZyme Information: RAK77492.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK77492.1
• CAZy Family: GH27
• CAZyme Description: putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		50946.67	4.7248

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824642:333502-335015(+)

Full Sequence      

MILSPRWWTALLAVLTVGQHTVRALQLDLNDEQSIKNAAATAAYNMMSYYHGNESGQIPG
KLVDTWWEGGAMFMTLIQYWYWTGDTSYNAVTTEGMLWQKGQNDYFPANYSNYLGNDDQV
FWGLAAMTAAELNYPEEDGQPSWLSLAQGVFNTQVPRWDTTSCQGGLRWQLWPYQAGYTT
KNAISNGGLFQLAARLGRYTNNETYSNWAEKIYDWMATTPLLREDQWSIADTTTTQTECK
DHGDLQWTYNYGTYISGAAYMYNHTNGGDKWKKALDGLLGTTLQKFFPQEFGGNIMSEIS
CEPNMMCDRNQDCFKGFLSSWLTFTTTIAPHTAGEIIPKIQQSALAAAKQCSGGKSGTEC
GRRWHQATWDGETSLESDMSALSVFSSTMIAHKGQEQSHQGPLTSETGGTSKSDPNAGTA
PKNPPNELPEITAGDRAGASILTVAFVCGWAAAVAWLVHGG

Enzyme Prediction     

No EC number prediction in RAK77492.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	395	2.2e-103	0.9441340782122905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	34	382	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.008	117	255	93	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95806.1|GH76	6.00e-291	5	461	4	462
BCS08339.1|GH76	6.00e-291	5	461	4	462
CAK43770.1|GH76	1.46e-285	5	461	4	456
QMW25974.1|GH76	6.66e-266	3	461	1	457
QRD87981.1|GH76	6.66e-266	3	461	1	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.63e-102	18	436	18	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	7.05e-108	11	458	9	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	4.25e-104	13	458	10	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	7.28e-104	17	459	11	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	4.57e-101	9	421	4	412	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	9.66e-97	24	458	18	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999765	CS pos: 24-25. Pr: 0.9712

TMHMM  Annotations     

Start	End
438	460