CAZyme Information: RAK77174.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK77174.1
• CAZy Family: GH2
• CAZyme Description: putative UDP-glucose:glyco protein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1493		166256.13	4.8876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824644:381379-386042(+)

Full Sequence      

MVSGSALFASWRLSSVIVASALSCLVHATTPSVNVALQASFDSAPYLIELLETAAEENST
SYFPILDRIAEGAFDDAVTDKELYDRFLEVIHTDGHLRTPEALSSFKLSLSIRSASPRIA
AHYQYYNASVQHSLAAAQDAVCPVWVHAEGKQYCSSTLERAQQGVMGPSDPPELPFDRIL
GDYSLPPAILYADLASPMFKDFHQSLTALARDGQFSYRVRYRPPQHWSSRPLFVSGYGVE
LALKRTDYIVIDDRAAEERSSDASGSKKSVNGEGDDLDDLRPLSSSEVSRLGPGTVGYVL
DSQSPLDTLVELSQDFPKYSAKIAAHNVTKELLQDIQTSRLRMLPPGFNALWINGVQIDA
RQVDAFTLLDHLRRERKLIEKFRNLGLSASESVDLLSHKFLAAAMAQDGPQRYNYRDEIE
GGGVIMWLNDLEKDARYESWPSDLGGYMQRVFPGQLPSVRREANNVVIPVDLAKLDDATL
IVKSIQVFVKNKIPVRFGLVPTTSSPGSIAQLKVAHYLQDTFGLASLMSYLETSVSKNRL
SSPDKTAFQAATADRTARPDKQSLSLDEVLKNDAVDTIVSRTSEYLKRLGLTGEASHSFV
NGVPILRNENWAQELSSRVSRDIQAIQQSIADGELAEDTWLPGLFLSDAFDRRNPVIVPE
DPKDVRIVDMAQVAETYGELLESLPRIPSTQDNVLASSHVIVAGDFSDESGFNLLSAALG
SLKNHDEAEVLLLHNVGANSSIWTGSYTIHRYLKKWKKKDDVDAAKLLEELTGTDLWSRE
DKQEAESFWCAHQPLVKGLGLSSGANAIIINGRVIEVPVDVALTSDDVDQLLAYERQKRI
APVAKAAEALGFGAKLSDPLTLAKLTSLAALSTVSEVPEGIYESTPDIRVNLFERWDKAR
STITVSNSEDPVITIVASIDPTSEVAQKWLPILKVLSDLANVRMRLVLNPRDELQELPTK
RFYRYVLDLEPSFSQDGTVARPTASFSGVPVEALLTLGMDVPSSWLVAPKESVYDLDNIK
LSSVKEGTNVDAIYALEHILIEGHSRDLTMKTAPRGVQLILGTEESPQISDTIIMANLGY
FQFKAQPGLWTIKLKPGRSERIFQLDSLGNEGYSLHPNDDTSNEVALLSFQGKTLFPRLS
RKKGQEMEDVLETGIKSGSAMDYVSKGLNFASGVLSSVGINGSPKDVAGGKQADINIFSV
ASGHLYERMLNIMMVSVMRNTEHTVKFWFIEQFLSPSFKSFLPHLAAEYGFSYEMVTYKW
PHWLRAQTEKQREIWGYKILFLDVLFPLSLDKVIFVDADQVVRTDMYDLVSLDLEGAPYG
FTPMCDSRHEMEGFRFWKQGYWKNFLRGQPYHISALYVVDLSRFRALAAGDRLRGQYQML
SADPGSLSNLDQDLPNHMQHHIPIKSLPQEWLWCETWCSDESLAQARTIDLCNNPLTKEP
KLERARRQVPEWTVYDEEIAALEKRVRVEVQDVREEEVEAEADAAAGWDKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1195	1442	2.1e-134	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1195	1462	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	0.0	1195	1442	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	1.56e-92	413	657	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	4.86e-65	43	230	1	185	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	2.56e-58	1195	1442	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39488.1|GT24	0.0	1	1493	1	1495
CAS97678.1|GT24	0.0	1	1493	1	1495
BCR94558.1|GT24	0.0	1	1493	1	1495
BCS07152.1|GT24	0.0	1	1493	1	1495
BAE65008.1|GT24|2.4.1.-	0.0	1	1493	1	1487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	28	1469	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	28	1469	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	32	1158	5	1130	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	28	1469	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	28	1469	6	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.11e-281	25	1462	15	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	7.70e-232	17	1463	28	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	2.33e-231	26	1469	40	1530	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	9.03e-229	17	1463	28	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q0WL80|UGGG_ARATH	3.18e-226	32	1456	32	1562	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000306	0.999661	CS pos: 28-29. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in RAK77174.1.