CAZyme Information: RAK77159.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK77159.1
• CAZy Family: GH18
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	KZ824644|CGC2	64400.91	6.5303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824644:340396-342470(+)

Full Sequence      

MEDREFYDYIICGGGTSGCVVAGRLAENPQVRILVIEAGQHNKDLESVHMAGAWSTNFDK
ETDWNIVTRPMSGVDNRQVKLSRGRFLGGSSGCNGTLCIRGCKQDYDDWGLDGWGGQEFF
QCMRKAETFHSKPWFKANHEYHGQSGPLHVEPHDLAPISNLIMDSFVSQGLPLDHDMFTT
GETPHGCGHVPRTVHKGIRTTSGDFITNGYLRSNVTVMTETTVDKVLLGHGSEGLKAEGV
VVITPDGPRSIYAKREIIISGGAYCSPAILMRSGIGSKEELSKHDIECKVDLPGVGQNLL
DHMIVFMFYETEKPGLTNDYLVHHGDSFEKSYALWKEKKKGFLSTFPFGCFAFARLDDRL
KDEPLWRDAPREPGRDPMGLTPKQPNVEFFTTECYGGPKQYDQFPTDHKHAFSIIAELFS
PRSRGSVTLSSKNPLENPIVDCNYLSDPLDLLVLTEACRFANEIITQGAGTKDIVKGSWP
PNLTHHTYTKREEWIPYVKEHGTTCYHAAGTCAMGKDGDPNAVLDHKLRVRGVSGLRVAD
CSVMPTLHGGHTQMPAYGIGEKCADLIKETWSTPPLGGMSKL

Enzyme Prediction     

No EC number prediction in RAK77159.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	569	7.8e-161	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.19e-110	1	568	1	532	choline dehydrogenase; Validated
225186	BetA	1.34e-98	7	569	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.21e-40	421	563	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.41e-33	74	304	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	7.00e-25	5	543	54	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07163.1|AA3_2	0.0	7	576	5	574
UDD65288.1|AA3_2	0.0	4	572	6	575
QMW48130.1|AA3_2	0.0	4	572	6	575
QMW36070.1|AA3_2	0.0	4	572	6	575
CAK49001.1|AA3_2	0.0	1	582	1	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	3.38e-77	3	568	3	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	4.73e-77	3	568	3	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	6.61e-77	3	568	3	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	8.00e-65	7	572	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	5.18e-57	7	568	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.43e-77	1	567	1	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	5.93e-77	4	575	2	538	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	2.27e-76	4	575	2	538	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	1.54e-74	7	567	5	530	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q47944|SDH_GLUOY	2.08e-70	7	568	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RAK77159.1.