CAZyme Information: RAK76758.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK76758.1
• CAZy Family: GH17
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		54228.78	4.9211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824646:15683-17506(+)

Full Sequence      

MGSAGASTLPKDFLWGFATASYQIEGAVAEDGRGPSIWDTFCKIPGKIADGSNGDVACDS
YHRVDEDIALLKQCGAQAYRFSISWSRIIPLGGRNDPINQKGIDHYSAFIDRLHAAGIVP
LVTLYHWDLPDELDKRYGGLLNKEEFVADFTHYARVLFAAFGSRVKHWITFNEPWCSAVL
GYNVGQFAPGHTSDRSKSSVGDGSREPWIVGHNLLVAHGAAVKVYREEFKERDGGEIGIT
LNGDWAEPWDPANPADVEACTRKIEFAISWFADPIYHGKYPDSMVQQLGDRLPAWSAEDR
ALVLGSNDFYGMNHYCANYIKAKTGEPDPTDTAGNLEILLQNKAGEWIGPETQSAWLRPC
AIGFRKLLKWLSDRYGQPKIYVTENGTSLKGENNLPVEQLLQDEFRVQYFRDYIAAMADA
YTLDGVNVRAYMAWSLMDNFEWAEGYETRFGVTYVDYENGQKRLPKESAKQIGKIFEQYI
EKE

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	477	1.2e-163	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	10	470	1	424	beta-galactosidase.
395176	Glyco_hydro_1	0.0	8	470	4	442	Glycosyl hydrolase family 1.
225343	BglB	2.83e-146	7	477	2	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.86e-117	9	469	28	473	beta-glucosidase
215455	PLN02849	3.43e-113	7	469	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12207.1|GH1	0.0	1	482	1	482
BCS00431.1|GH1	0.0	1	482	1	482
QEV81508.1|GH1	0.0	1	482	1	482
CAK47813.1|GH1	0.0	1	482	1	482
QRD82378.1|GH1	0.0	1	482	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	9.00e-274	8	483	25	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.92e-243	9	483	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5BWF_A	1.12e-240	5	483	18	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	3.22e-240	9	483	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
3AHY_A	7.13e-234	9	480	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	4.79e-192	3	480	5	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.16e-181	6	481	3	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9M1D0|BGL16_ARATH	9.52e-142	10	476	36	500	Beta-glucosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGLU16 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	1.19e-141	8	476	38	508	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	4.76e-141	8	476	38	508	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RAK76758.1.