CAZyme Information: RAK76574.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK76574.1
• CAZy Family: GH16
• CAZyme Description: neuraminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		47733.10	6.4659

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824648:312088-313368(-)

Full Sequence      

MPDFGHKILNKLGLHDHHDQQQQQQQQYDQQQYGQYNQQQYDQQQYGQYNQPQYGQYNQQ
QYQYNQQQYGQQQQQQPMGYPGQGHGHPRPNRHVHHDERALSNGNGGTYPRLARLSDGSL
LSSFTRFPGDGQRALVVARSTDGHNFEDIGEVTRGTGDTDNLFLLEVAPSVVLGAFRNHD
HDPSGRPTHFRITVCRSHDGGHTWQFASQAAEKPGGDGLGVWEPFMRMGAAGEVQLTYSQ
EMAHNNQCTMLVTSTDQGSTWSEPRCLHGKDDKRRDGMNGIARTHDGDREALVMVFETNT
RGPMQIEGLISYDDGRSWGNRHIVYSPRDGHRHNAGAPQIASFADGSLAVVFMTDEDHQE
VDWTKNACIKAVFGPPPANGQIQWDHSATTICGESSHWPGVFGLDGHTVLATYECRGPKA
RAISLQ

Enzyme Prediction     

No EC number prediction in RAK76574.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	106	368	3.9e-65	0.8990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.30e-10	164	355	19	219	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	2.10e-08	185	359	167	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	0.002	192	368	20	195	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
271234	Sialidase_non-viral	0.004	102	204	194	293	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	7.81e-151	91	426	43	376
BCS11580.1|GH93	7.81e-151	91	426	43	376
QMW42642.1|GH93	3.90e-149	78	425	40	378
QMW30589.1|GH93	3.90e-149	78	425	40	378
QRD89469.1|GH93	3.90e-149	78	425	40	378

PDB Hits     

RAK76574.1 has no PDB hit.

Swiss-Prot Hits     

RAK76574.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RAK76574.1.