CAZyme Information: RAK76511.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK76511.1
• CAZy Family: GH16
• CAZyme Description: alpha-L-rhamnosidase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	KZ824648|CGC1	71336.61	6.2715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824648:129256-131307(+)

Full Sequence      

MLWSSWILTPALLAIGSHAVPFEDYILAPHSRTLNPSLVYQVNGTVDNPEALVGLTTHQT
TLHGKSSVTYDFGRNIAGIVSLDVTSVSSKAAQLGVTFTESSLWISSEACDATSDAGLDS
PLWFSVGHGPGTYGADKKHLRGAFRYLTLVNNSTATISLDGLSINYTAAPTQDLRGYKGY
FHSSDELINRIWYAGAYTLQLCTIDPTTGDSLIWLGVITSSDNITLPQTDSWWNNYTITN
GSTTLVDGAKRDRLVWPGDMSIAIESAAVSTADLESVRTALESLFVLQKANGQLPYAGRP
FLDIVSFTYHLHSLIGASSYYQYTGDRSWITRYWGQYKKGLQWALSSLDNSGLANITASA
DWLRFGMGGHNIEANAILYYVLNDAISLARSLDDRANVGNWSTAASKIKAAANARLWDAQ
NSLYRDNETTTLHPQDGNAWAIKANLTLSSNQSEAISSALAARWGPYGAPAPEAGSTVSP
FIGGFELQAHYLANEPDRALDLLRLQWGFMLDDPRMTNSTFIEGYSTDGSLAYAPYRNTP
RVSHAHGWSTGPTSALTYYTAGLRLTGPAGSTWLFKPQPGNLTEVQAGFETQLGLFATQY
QKSATGTFQQLTFTAPNGTSGSVEIEGATGQLISKRGQAVKLVNGKARGLQGGTWTLKGL

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	243	624	4.5e-74	0.7281746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.86e-14	179	512	4	302	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225922	SGA1	0.001	238	424	265	468	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
273702	oligosac_amyl	0.002	314	418	359	459	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
379972	Bac_rhamnosid_C	0.005	562	633	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK16249.1|GH78|3.2.1.40	0.0	1	660	1	660
BCR95812.1|GH78	0.0	2	657	1	653
QBS54793.1|GH78	0.0	2	657	1	653
BCS08346.1|GH78	0.0	2	657	1	653
BAF98236.1|GH78|3.2.1.40	0.0	2	657	1	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.92e-10	65	582	191	658	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.14e-07	247	559	237	541	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

RAK76511.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999735	CS pos: 19-20. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in RAK76511.1.