CAZyme Information: RAK76139.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK76139.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	KZ824651|CGC3	54040.98	5.1221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824651:200540-201976(+)

Full Sequence      

MSRINRHPSLLIAAAFLAACLIFLLSSSRRTATTEPLSHNELNQPSSSPNDYTNPCYVDL
DLLRQYSPTSSSIEYARLEIAVDQSDNFTGYTDTLDAKFPKFRTVSLEGDAQRQDLSAER
CAPAVTIQGPRPRPRPDASHLVFGVATSMERLLDSLDAFAHWAGGTNARILAVVDSAGAA
KKGALARAEALGIRLVIREKAVEERLDRWFYLVRYLYELRDDNTQWTVLIDDDTFFPSME
RLVDRLATYDPTQPHYVGSMTEDLHQLYSGGLMAYGGAGIFLSLPLVQQLQPFFDECYVF
KSGGDRMLSQCIYAHTNTKLTWEKGLFQVDLRGDASGFYEAGREQPLSVHHWKSWFQADM
VALSKVASIAGDEALLHRWLLPRDWYLVNGFSVIQYATISDDPLPMEQTWDDSKYTGPDP
FTFSLGPLRRKDENKISYRLQTAVAERERVRQIYTRQVEPERLEVLEVVWVVASADNP

Enzyme Prediction     

EC	2.4.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	4.38e-14	223	351	210	341	hypothetical protein; Provisional
398362	DUF604	1.20e-11	273	351	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	1.49e-06	226	292	87	161	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96058.1|GT31	6.79e-226	3	470	12	473
BCS08579.1|GT31	6.79e-226	3	470	12	473
CAK44001.1|GT31	1.06e-225	3	468	11	470
QRD89155.1|GT31	1.20e-181	12	470	19	467
BAE54694.1|GT31	1.20e-181	12	470	19	467

PDB Hits     

RAK76139.1 has no PDB hit.

Swiss-Prot Hits     

RAK76139.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.988555	0.011456

TMHMM  Annotations     

Start	End
7	26