CAZyme Information: RAK75976.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK75976.1
• CAZy Family: GH13
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		93013.87	4.6920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824653:334931-337582(-)

Full Sequence      

MPSAVALIALIAPVLWGCLALTPLVHAHSETLVHPTRYRTNAGFRNYTSDTQSPCFTLDP
QTPLVTLDYGTEAAGFPYFEVESLSTPVQIEAKYSEPYTGLDEPFADGPFDFANGLSNTF
RVETFNVTSTGRVESFFIQGGQRWHTLKLLTDGSIRICDVGLRSENDRTPVDRLPGFFES
SNSLYNEIWALGARTVQQACIAAGAAPSTWEVTEDGVYLRGQQPAQSVKGASFDNYTLTF
DTKIVRGGSGWKVAAGVGGYGAYFVLTSEYPSDSTFVNVNRTVVPPNTLAVGYGWNLVNQ
TSLTSGKVNHYPLPFDVKEDQWYHIATRIDATGYGVTVNETEVFVPLADLQTPAGTIGGS
GSLTGGTWGFGPYQDQVALVKDVEVHAQNGTVLYQNPMTSDAVLEEYGVLPNTHSVCLDG
AKRDRLVWSGDFFHTYRIVQASTYRSDFISGTLEYLMDRQADNSSVYEGLFSMSPQMGQS
AEYTDIYSSFGLLDYQFFTLEAVAGYYKNSGDRAFLQKYWTKIETGVEAVLRLIDEQTGL
AVTDNIGAFFLGSSNGTAASALLAHTLSEMADLATAVNATESASSWSQSAQTIKQAVNQH
LWSPSLGAYGVDIGTLGEQAIAGSAWAILSGIANATQTQSSIAALSSLRLGIGYKSSTSV
ANSSSTNLAPFLSGFLLEALFQASRDSTNASTERRTAISVLLDQLWAAMVTQDEYYTGTS
WEYLYPDGRPGLDLYTSHAHPWGGAPTYVLSEYVLGVQSTSPGFDTWVFQPAILDVNVSW
ARGRVPTPRGTIQASWRLSGADKKSLQLEVCGPKKTRGVVILPFAVKSYTVDGKMKSNGK
ERLEVAVAGGSCAEIRASLP

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	406	822	5.1e-71	0.748015873015873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	8.57e-12	756	834	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	8.76e-07	399	612	8	224	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ93894.1|GH78|3.2.1.40	0.0	28	857	59	885
BCS14345.1|GH78	0.0	40	857	50	864
CAK46278.1|GH78	0.0	30	857	29	829
BCS02687.1|GH78	0.0	133	857	2	723
BCR89915.1|GH78	0.0	15	855	10	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.89e-09	413	792	326	672	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

RAK75976.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999726	CS pos: 27-28. Pr: 0.9724

TMHMM  Annotations     

Start	End
5	27