CAZyme Information: RAK75853.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK75853.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		48145.11	6.1790

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824653:45739-47043(-)

Full Sequence      

MSLRLRRLLPAIVIIAVIYTFHHTFSFSSSPPALPLHPTPSDCALPPIYDDVLVILKTGI
TEARTKVPPHLTTTLRCIPNYVIYSDYAEPLSSTVSTQDILGSYISSATKSTNPDFGLYN
RVRIAGHAGLTPADLVADVNTPIGKPNNPGWKLDKWKFLPMVDAALAARPSARWFVFMEA
DTYLLWHNLAAWLARFDPHKPWYLGNQMQIVDALFAHGGSGFVLSRPAMELARDLRAQSG
DGWETAVDAHWAGDCLLGILLESCGVALTWSWPILQIAPPGEVDFFGVRADTPDRVWCYP
AVSFHHLDGEADLRGLVEMEKGWDRDGYTGRVMVYRDVFWRVVWGQIQSPKDGWDNLVGD
EVGPTATVDECREMCAHEALCLGYRFAVGEGRCWLGRGMQLGKKADGFTSGWMTHRIQAV
ADSLGRCEAISWIG

Enzyme Prediction     

No EC number prediction in RAK75853.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	8.27e-11	173	271	86	198	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238533	APPLE_Factor_XI_like	2.53e-04	361	411	20	70	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
215605	PLN03153	0.001	170	230	209	275	hypothetical protein; Provisional
238531	PAN_AP_plant	0.003	365	411	31	77	Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions. S-receptor protein kinases and S-locus glycoproteins are involved in sporophytic self-incompatibility response in Brassica, one of probably many molecular mechanisms, by which hermaphrodite flowering plants avoid self-fertilization.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL00916.1|GT31	3.19e-163	8	433	8	421
BCS14707.1|GT31	2.59e-162	8	433	8	421
BCS03059.1|GT31	2.59e-162	8	433	8	421
QMW40773.1|GT31	3.20e-137	12	433	24	437
QMW28702.1|GT31	3.66e-136	12	433	24	437

PDB Hits     

RAK75853.1 has no PDB hit.

Swiss-Prot Hits     

RAK75853.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.961631	0.038383

TMHMM  Annotations     

There is no transmembrane helices in RAK75853.1.