CAZyme Information: RAK75705.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK75705.1
• CAZy Family: GH125
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		63043.14	4.9968

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824654:37182-39042(-)

Full Sequence      

MNPQVDTPLEADYVIVGGGTSGLVLAARLSEGDSARSVIVLEAGKNLVEDPRVQTPALWT
TLMGSEADWQYQSTPQPALGNRVIKEPQGKLLGGSSGINGQAFIAPTKAGIDGWEKLGAT
GWDWATLSPYYRKAFTLQLPDDNTRDHIGTGWVDTEANGTSGPIKVSFPAVRQDPLSKAW
VDTFRAMGYGVTGDPFSGVSTGGYSNLAAVDAETKTRSYAATGYGVPASQRPSVRILTNA
VARRIRLESEESGVTATGVDADIEGQATVVKAKKEVILTAGALNTPRLLELSGIGGQAIL
DKFSIPVVIDNPNVGENLQDHLMSGISFEVKPGVVTGDPLLRQEPDAIQTALQLYAEHKA
GPMTVGGVQSCAYMPIIESHGHQEAKRAHLETFPSDPDARHEVIRDIYGGLDAPTCSMFI
FVGQELLPGNYLSLGVSRSLPFSRGAVHIASVDPDAPLTIDPRYFSNPLDLDIMARNLLD
VERLHGLRPLADYLAADGRRNHPDASLTDLDSAKRYLRDTATTTYHSCGTVAMLPREKGG
VVDERLRVYGTTNLRVCDASIFPLIPAANIMSTVYAVAERAADIIRAEA

Enzyme Prediction     

No EC number prediction in RAK75705.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	587	2.9e-173	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.53e-109	10	586	5	532	choline dehydrogenase; Validated
225186	BetA	2.74e-100	9	589	6	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.35e-38	441	581	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.77e-28	77	322	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.56e-25	12	574	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02826.1|AA3_2	0.0	1	586	1	599
BCS14479.1|AA3_2	0.0	1	586	1	599
CAK46356.1|AA3_2	3.51e-316	1	588	1	601
QDL52568.1|AA3_2	4.91e-314	4	588	5	602
QSS49637.1|AA3_2	8.53e-263	8	589	7	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.73e-89	12	589	7	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	3.06e-65	10	585	35	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	1.65e-64	10	588	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.36e-63	10	588	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	4.22e-63	13	588	8	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.58e-102	12	588	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.76e-92	5	586	10	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.76e-92	5	586	10	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	5.02e-90	12	585	48	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.02e-90	12	585	48	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000002

TMHMM  Annotations     

There is no transmembrane helices in RAK75705.1.