CAZyme Information: RAK74943.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK74943.1
• CAZy Family: CE5
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
992	KZ824663|CGC1	110211.91	4.3585

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824663:185353-189322(+)

Full Sequence      

MKLVSIAALLLGAVPVAVNAAAVGGTPNGAKIIPVSDAAGLRSVGAHSSKYPNRKTVTIR
PSKNDYDDISSDFLWGIKQANHGGRLLLEKGKKYVIGKKLDLTFLDNIEVQLEGELKFTN
NITYWQANNYYYDFQKSITFWRWGGNDIKIFGSGTLNGNGQAWYNAFAGLEILDSSNTFY
RPILFLTDNATRVSVEGITQLNSPCWTNFFVNTKDISFDDVYIHAFSTNASALPKNTDGF
DSYNVDGLTVTNTRVDIGDDCFSPKPNTTNIFVQNLWCNNTHGVSMGSIGQYPGELDIIE
NAWIENVTLLNGQNGARLKAWAGPDVGYGRINNITYKNIQIQNTDNPVVLDQCYFDINAT
ECAQYPSSVNITNILFQNIWGTSSGKEGLVVADLTCSPAAVCTNVTLQDVSLTSPAGSPA
EIICSGITGGIGVDCGSGKTTLLEHILQSPDHGLRIAVIVNDMSSLNIDATLIKHHTVSH
TKESLIQLQNGCICCTLRGDLLSELARLTTQKEVEYVVIESTGISEPMQVAETFTEEFST
AMVQAEAEGGVLDEEGKKILDQINTLGGLHQLSTLDTTVTVIDAFNLLSNLDTTDFLSDR
YGADTIIPEDERTISDLMVDQIEFADVILINKMDMLASRPHDRDRIMQLVTTLNPSAKVL
QTSYSRVDVKEILGTGRFDFLKAASGAGWLRSLHEMSKLKMGNGEERWAPTPETLEYGIN
NFVYTARRPFHPRRLYNLLHDKFIILQNAADDAGADDEEEEEEEEDQEEDATAESDTEMH
SDSEEEEEEEEDPTQPTPQEILANKRAHPLLQPLLRSKGFFWLATRPYQFGEWSQAGAML
TLNCGGPWFAEVPDEAWPEDGDVRKSIEEDFQGEWGDRRQEIVFIGEGVDVDGVTGLLNE
CLLSTKEMKKWEKVMRDRKMERGGKQKVMAGIWEDGWEEWPAVDEKDEDEGEDEDDENDD
VEEKTEDGKKKRKISEFMHGGHAHHGHSHKHK

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	80	427	4e-70	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223597	YejR	4.85e-69	436	903	11	322	GTPase, G3E family [General function prediction only].
349766	CobW-like	7.21e-66	436	676	10	198	cobalamin synthesis protein CobW. The function of this protein family is unknown. The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K.
396860	cobW	1.05e-48	436	661	10	179	CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans.
395231	Glyco_hydro_28	2.28e-46	97	430	14	318	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	1.81e-34	108	449	111	436	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12452.1|GH28	1.30e-247	29	435	26	431
BCS00686.1|GH28	1.30e-247	29	435	26	431
UPX44877.1|GH28	3.61e-244	1	439	1	436
QRD92857.1|GH28	3.83e-243	17	435	12	430
QMW36166.1|GH28	3.83e-243	17	435	12	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.45e-45	68	440	26	387	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	1.27e-21	76	397	10	322	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
6KVE_A	1.27e-20	145	431	75	342	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.71e-20	145	431	75	342	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	5.00e-20	145	431	67	334	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DAX2|PGXB_NEOFI	2.04e-245	1	437	1	433	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q2TW03|PGXB_ASPOR	4.81e-244	17	435	12	430	Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxB PE=3 SV=2
sp|B8NX60|PGXB_ASPFN	6.80e-244	17	435	12	430	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1
sp|Q27UB1|PGXB_ASPNG	1.08e-243	29	440	26	435	Exopolygalacturonase B OS=Aspergillus niger OX=5061 GN=pgxB PE=3 SV=1
sp|A2QHG0|PGXB_ASPNC	1.08e-243	29	440	26	435	Probable exopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999718	CS pos: 20-21. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in RAK74943.1.