CAZyme Information: RAK74787.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK74787.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	KZ824665|CGC1	59502.22	5.1684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824665:214866-216437(+)

Full Sequence      

MPVFRMKTAVPLIALFSIAFFFWCVERFDRAAFLRFKQPADHVAGTTSPQIQLQPTSPST
KSCDVDTNIQPPLPMAEWLPRKNYTRAYFRPHHVSPKAEFSSLESIEVPVLPPMTVMERG
MVVSPDNKESSLPCPPVIDVNVAADHDVDETDKLLFGLATTADRLDRLLPSLLYSYGNTK
VGLIVLVPDSDDDIPKQETYFRNRGLDLTLIQSPLDFTARYFGLVQAFAEHIKTKRPQTQ
WVSFIDDDTFFLSLPTVAEELKLFDASKKHYIGALSEASWQVDTFGHIAFGGAGVFVSKP
LLDVLVDKYDECQSWGEQPGDQKLGQCIQRYGDTPLTLWPSLYQMDMKGEVDGVYESGRK
IESLHHWNSWYTKDVVKMTTVAAAAGRRSVLRRWVFDQEEIVNNATGRSTRTFWVFTNGY
SLVKYTYDENTPDDAINFDHAEKTWEEDPRGYEARLGPLRWRDQDGVTKDRWLLREAYVV
GDNVHQWYVREEDEGHSVIEIVWLGPKGGGGAGINDFAVRRQH

Enzyme Prediction     

EC	2.4.1.-:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	5.86e-11	237	393	209	375	hypothetical protein; Provisional
398362	DUF604	0.002	289	383	10	106	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	0.008	241	344	87	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41322.1|GT31	0.0	1	523	1	520
BCS14594.1|GT31	0.0	1	523	1	520
BCS02946.1|GT31	0.0	1	523	12	531
BAE62723.1|GT31	0.0	1	523	13	537
QMW32971.1|GT31	0.0	1	523	1	525

PDB Hits     

RAK74787.1 has no PDB hit.

Swiss-Prot Hits     

RAK74787.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000021

TMHMM  Annotations     

Start	End
9	26