CAZyme Information: RAK74324.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK74324.1
• CAZy Family: CBM67|GH78
• CAZyme Description: alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744	KZ824670|CGC1	83206.73	5.7477

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824670:218146-220380(+)

Full Sequence      

MYFLLTLLVVGHCLADYFHPNSTGLRLQHGFETLLIQPYGYDGFRVRAWPFRPPTGQEIS
FIYDPPLEGFENGTAHGMSYDQTSTGETPLTLRNGNLLLRTTGWGGNEGGYRLSFSRLNA
DGSETLLTNEYAPLKSLNPRTYTWPGPGAEFRAEFSFSATPDEQIYGTGTQQDHRINKKG
SVIDLVNFNTYIPTPVFMSNKGYAFVWNTPAEGRMEFGALRTKFVAESTTLVDYVIIAAD
DDSANNNNTTSSVSKYDTLQRRLSALTGRAPTPPAFSLGYIQSKLRYENQSEVEQLARSF
AAHDIPVSLIVIDYQSWAHQGDWALDPRLWPNVSQMAAVVRNATGAELMASLWPSVADNS
VNYATLQAQGFLSATRSGPGTTDSWNGSYIRNYDATNPLARHFLWSTLHRNYYTHGIKNF
WIDQADGGALGEAYENNGQSTYIQSIPYALPDVLYAAGTQRGVGKLYPWAHQQAIDEGYR
NVTATAPGDPCPHISLSRSGYIGSQRFCSIIWSGDTTSVWDTLAAQIASGLSAAATGWGW
WTVDAGGFQADPTVAWSGDIDTPEFRELYVRWFAWATFLPFMRTHGSRACSVQSAYTCAN
EPWSYGAENTPIITGYIRLRYQLARYLTNVFERFSTEGRSIMRPLYMDFEHTDRNVSGLV
AANTNFTTQSYMFGPRLLVSPVTRPNVSEWEVYLPRTGERGKWTYWWSNETFAGGEVVTV
KAPREHIPLFFWGTREEILSGEVF

Enzyme Prediction     

EC	3.2.1.177:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	255	731	2.7e-109	0.9672131147540983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269877	GH31_xylosidase_XylS	4.90e-124	268	620	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
224418	YicI	1.67e-104	156	730	146	663	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.04e-103	261	730	13	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	6.68e-49	268	731	1	420	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
269884	GH31_transferase_CtsZ	2.13e-47	268	627	1	326	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR98697.1|GH31	0.0	15	744	18	736
BCS11022.1|GH31	0.0	15	744	18	736
DAA35002.1|GH31|3.2.1.177	0.0	15	744	18	736
CAK40270.1|GH31	0.0	15	744	18	736
BCR92450.1|GH31	0.0	16	744	29	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	0.0	17	744	2	718	Xylosidase from Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
7KMP_A	8.00e-49	252	730	412	858	Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
5JOU_A	3.27e-47	265	730	394	837	Bacteroides ovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
2XVG_A	4.05e-44	266	730	423	867	crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
4B9Y_A	1.17e-31	152	729	141	664	Crystal Structure of Apo Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31 [Cellvibrio japonicus],4B9Z_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with Acarbose [Cellvibrio japonicus],4BA0_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with 5F-alpha-GlcF [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QTU5|XYLA_ASPNC	0.0	15	744	18	736	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
sp|Q01336|YCR2_PSEVU	2.05e-72	19	588	7	525	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
sp|Q9P999|XYLS_SACS2	6.98e-69	151	730	100	615	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
sp|A7LXT0|GH31A_BACO1	1.67e-46	265	730	393	836	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	1.45e-39	163	730	147	667	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999751	CS pos: 15-16. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in RAK74324.1.