CAZyme Information: RAK73871.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK73871.1
• CAZy Family: AA9
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	KZ824674|CGC1	74524.17	7.1359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824674:39745-42444(+)

Full Sequence      

MTIPDEYDIIVCGGGSTGCVVAGRLANLDHNLQVLLIEAGEDNLNNPWVYRPGIYPRNMK
LDSKTASFYYSRPSEWLDGRRAVVPCAHVLGGGSSINFMMYTRASASDYDDWESAGWKTD
ELLPLMRKHETYQRACNNRDIHGFEGPIKVSFGNYTYPIMQDFLRAAESQDIPITDDLQD
LKTGHGAEHWLKWINRDTGRRSDSAHAYVHSTRSQYSNLHLKCNTKIDKVIIENGRAVGV
ATVPTKPLAGHNPPRRVFKARKQIIVCGGTLSSPLILQRSGVGDPEKLRRAGVEPLVNLP
GVGRNFQDHYLTFSVYRAKPDVESFDDFVRGDPEVQKKVFDEWNIKGTGPLATNGIEAGV
KIRPTPKELEEMKTWPTNDFYKGWESYFKNKPDKPVMHYSVIAGWFGDHMLMPPGKFFTM
FHFLEYPFSRGFTHIQSADPYESPDFDAGFMNDKRDMAPMVWGYIKSRETARRMHAYAGE
VTGMHPHFSYDSPARAFDLDLATTKAYAGPNHLTAGIQHGSWSAPLEPGTSPTTTFLNSN
KQDTRDELKYTAKDIEHIEKWVQRHVETTWHSLGTCSMAPRAGNALAPQGGVVDERLNVH
GVRGLKVADLSICPDNVGCNTYSTALLIGEKCAVLTAEDLGYRGAALEMRVPEYHAPGET
KGLSRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	641	1.3e-256	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.63e-82	6	633	5	528	choline dehydrogenase; Validated
225186	BetA	7.91e-81	1	639	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	7.90e-48	78	310	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	6.59e-26	427	632	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.62e-10	7	629	56	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10225.1|AA3_3	0.0	1	666	1	667
CAK97466.1|AA3_3	0.0	1	666	1	667
QMW39314.1|AA3_3	0.0	1	666	1	666
QMW27243.1|AA3_3	0.0	1	666	1	666
QRD81611.1|AA3_3	0.0	1	666	1	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	0.0	1	665	1	662	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	1.51e-239	4	657	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	2.45e-238	4	657	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5OC1_A	9.99e-49	6	639	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.92e-48	6	639	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F2QY27|ALOX1_KOMPC	0.0	1	665	1	662	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	0.0	1	665	1	662	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|F2R038|ALOX2_KOMPC	0.0	1	665	1	662	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|P04841|ALOX_PICAN	0.0	1	665	1	663	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	0.0	1	665	1	662	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

There is no transmembrane helices in RAK73871.1.