CAZyme Information: RAK73608.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK73608.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	KZ824678|CGC2	57262.91	4.1117

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824678:202633-204426(-)

Full Sequence      

MKYNSIALAGASMLLGRAIAADLPEIAIKGNKFFYSNNGTQFYMRGVAYQQDYTANGTSS
DNNDYIDPLADATSCKRDIPYLQQLRTNVIRTYAVDPTQNHDECMTALADAGIYLITDLS
SPSQSINRNDPQWNTALYDRYTSVIDAFANYTNVIGFFAGNEVTNDNNNTDAAAYVKAAV
RDMKKYIKAKNYRTTLGIGYATDDDATIRDDLKDYLVCGDSEDMIDFFGYNIYEWCGDSS
FKTSGYQARTEEFKDYPVPAFFSEYGCNDPSPRTFTDVPVLFGSDMDDVWSGGIVYMYFQ
EANDYGLVSVSGNSVSTLKDFSNLSSQMQKATPTGVNSNSWSASNTATSSCPTVASAWEA
SSSLPPSPNDALCDCMEDSLSCVVKDSVSSSKYGDLFDYICALNDGKYCAGQASNSTSGT
YGAYSVCSTKQQLNFVMNQYFSAQGASASACDFSGKGTTTSSQSPTGTCSSLLKEAGTGG
TGSVTSSPTGGSAASASSSSSEGAAGMGVSPMAVSVGSWQLGAYAVTAVGAALGMILL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	21	330	8.6e-139	0.9871794871794872
CBM43	381	470	2e-19	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.67e-170	18	331	4	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	5.09e-28	380	458	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	2.91e-20	380	471	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	4.20e-06	26	321	1	265	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	2.52e-04	25	210	319	484	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16538.1|CBM43|GH72	1.29e-298	1	538	1	537
BCS04977.1|CBM43|GH72	1.29e-298	1	538	1	537
EAA62091.1|CBM43|GH72	1.84e-249	5	538	4	539
EAL87626.1|CBM43|GH72|2.4.1.-	4.08e-241	7	538	6	548
BCR92446.1|CBM43|GH72	9.49e-231	5	538	4	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.33e-128	24	456	34	471	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	3.74e-128	24	456	34	471	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	3.74e-128	24	456	34	471	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XVI5|GEL4_ASPFC	7.25e-242	7	538	6	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	7.25e-242	7	538	6	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|P0C955|GEL3_ASPFU	1.10e-193	1	478	1	470	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	1.22e-193	1	478	1	470	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|P56092|EPD1_CANMA	3.69e-188	1	477	1	469	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000290	0.999710	CS pos: 20-21. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in RAK73608.1.