CAZyme Information: RAK72770.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK72770.1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862		94311.91	6.3555

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824689:126969-129757(+)

Full Sequence      

MSSADLQKRVGQLFVVGFHGLEPSAEIKTLIHEYGVGGIILFKRNITDVAQLRALTDALQ
REAQLAGHTHPLFIGIDQENGWVTRISPPMASQLPGPMALGATNSTDLAYKVGMATGQLL
KHVGINMNYGPVCDINSEPLNPVIGVRSPGDDPEFVGRFASAIARGQRQHSVISCVKHFP
GHGDTATDSHYGLPVISKTREQLEKCELVPFRRAAAEGIEAVMTAHISLPGLGDGKLPAT
LSPDVLSILREDMKNDGMIITDCLEMDGIRATYGTEEGSVLALAAGSDSIMICHTYDVQV
ASNRRVCEAVEAGRVSMTRVEEAYRRVTQLKQKSLRWEEALHTDGAFESRFREIDLQNRE
LADAAYAKSVTVVRDTSKNLPVSRSCKVILLFPGEETPAGGAVDGEGLGRKGSYNGSVYL
DALRNHNPTVTEIRYGAAGLSPEEWRKVEAADAVILTTINARESPFQRKLGQELPNRARA
LVSIAACNPYDFLDDPTIGTYITTYEPTLEAFSAAAATIFGAATATGKLPVGTQEPRLSI
ELSPLDYPEDLKQVHTVWNTSLPTYPLPLENLQKLLPQPHGHHFLARTGNTIVGFCLTYS
RTTTDDEEKSAYLSAIAVLPAAQSHGIGSTLIQEAIAWYTTTQQITRLDLSSSFPRFWPG
LPDDLAPSATKFFENRGFIFTTPPPRHVDLYRSITDFQLEERHTRKATSQGYTFAALQPA
QYEECIAGQQKNFSHNQAWVQTYITLHPQTHPDSIMTVFSPQGHQIGWTLMLDPSSPFLQ
TQWAMPPVCGGADSRTGLIGCVGVDREHRGKGVGVAMLTHALAHLRSRGVQGVMVDWVVL
EGFYESVGFDVWRGYRLGSVRI

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	70	291	3.6e-59	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.48e-84	10	416	7	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	8.25e-81	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.43e-49	36	351	26	336	beta-hexosaminidase; Provisional
185053	PRK15098	4.95e-12	6	393	47	418	beta-glucosidase BglX.
395465	Acetyltransf_1	4.53e-10	566	678	18	116	Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93582.1|GH3	0.0	1	862	1	859
BCS06215.1|GH3	0.0	1	862	1	859
CAK37722.1|GH3	0.0	1	862	1	859
BCR85716.1|GH3	0.0	1	860	1	854
CAP94355.1|GH3	0.0	1	860	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.81e-146	5	858	8	856	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.39e-94	6	530	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.62e-59	5	531	43	615	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.09e-58	5	531	17	589	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.92e-58	5	531	47	619	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.86e-58	5	531	43	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.24e-51	26	333	54	382	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q0A911|NAGZ_ALKEH	1.05e-36	15	341	7	332	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
sp|A9M1Z4|NAGZ_NEIM0	1.39e-36	24	298	21	294	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1
sp|Q7NWB7|NAGZ_CHRVO	1.07e-35	24	294	19	286	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RAK72770.1.