CAZyme Information: RAK72133.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK72133.1
• CAZy Family: AA3
• CAZyme Description: phosphoribosyl transferase domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1146	KZ824701|CGC1	125404.47	6.6559

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824701:22037-25477(-)

Full Sequence      

MSDLNFNIDNLSRSLIAKASSAGGPSSATEQRAASVTLDTESPTDQYLTTTHLTQLLNPL
FDSRDHVSVLEIRPGPKSILHYLSPRLRRKVWRYTAIEPEDSSATILEEWLHSTSKTESP
LPCLESPPNIRRISLDMAFPTLTGAMPVAYNSKERFDIIFFSHGTHSVLRFASMQWTLQM
LAKRPEGGMVVMIHDGTLPMYVTGLVCHKTASLPARTFRVVNDDAVLDRLDSFNTSSRLS
NRWRSFCRSVGRCEREDSDYLLIAMPTIMTVFQKHANSFGELTRLVPMLNKPLKDRVARL
NHSSLIVKPRNIQHVQDCVRWALKHGAGLTVIGGGHSGHCIRPHVASVDMIEFDEVHIVP
VEAGTEDSKLDAGSVVVAGGGCKTSDIIKKTMIAGLTVPLGSRPSVGAGLWLQGGIGHLA
RLYGLACDAIVGAVLVSVDSGQILWIGDVPIQHRPAGAVRPENESDLLWAIKGAGTNIGI
IVSVTFKAFVAPTCLVRNWAIPLTDRVEARQKLVEFNQFASKLPRNCTADAYLYLDMDQL
HLGVTMFEACTTDPTHELPYPMPNCTFLGSEHDIKDVDSVGLFDADMYMTKIHGGHRSGK
TYSFKRCLFLKQVGQADVTDILLTAMETRPTPLCYVQLLQGGGAVNDVAADATAFGCRDW
DFACMISGVWPREDEVEVAGAVERWVYDVAKDLLPLSSGSYSTDLGPDPRDSALAAKAFG
LNRLRLAHIKHSLDPHNVLAYACPLPKAPQHKLVILITGESCAGKDYCARIWASVFTHGS
FTVRTVSISDVTKRAYAAATGADLNLLLSDRAYKEQHRPALTEFFRGQARVRPQLPEEHF
LGVVYGAVDVDVLLITGMRDQAPVAAFSHLVPDTRLIDVRIEASEETRQARRGCQGRQQE
RKDKIDCGEGTSNSAALEYPPSLIFENDTPGDEAVREFGEQHLLPLVDENLQRLANMVRK
VHDFPRPAIDFRHVLGISQQPGGIGLCTSLLQSHFTGDWAKVGAIACCEAGSFVYGSALA
MQVDVPLALIREGGKLPQPTVSVPKSTSHISSMAPRESSCDSSEKRLEIEQGLIPEGASV
VVVDDVLATGRTLCAVLDLLVEAGIRAEDVSVMVVAEFPVHRGRELLRQRGFSNVNIRSL
LVFDGA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	304	541	2.8e-37	0.4672489082969432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235028	PRK02304	5.80e-30	949	1145	1	175	adenine phosphoribosyltransferase; Provisional
398111	P-mevalo_kinase	7.13e-25	757	872	1	111	Phosphomevalonate kinase. Phosphomevalonate kinase (EC:2.7.4.2) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. This family represents the animal type of the enzyme. The other is the ERG8 type, found in plants and fungi, and some bacteria (see pfam00288).
223577	Apt	3.74e-21	947	1145	1	179	Adenine/guanine phosphoribosyltransferase or related PRPP-binding protein [Nucleotide transport and metabolism].
177930	PLN02293	5.78e-19	948	1127	11	173	adenine phosphoribosyltransferase
223354	GlcD	7.13e-18	281	739	1	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA09402.1|AA7|CBM18	1.04e-13	299	738	72	511
UPK94696.1|AA7	3.00e-13	291	738	53	482
QRC92907.1|AA7	1.22e-12	306	738	66	483
QPH04356.1|AA7	2.55e-12	304	738	122	540
CAK49173.1|AA7	2.62e-12	304	737	48	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BVF_A	3.07e-17	300	492	36	206	Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVF_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVG_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVH_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans]
4X45_A	5.42e-16	946	1133	1	175	Crystal Structure of F173G Mutant of Human APRT [Homo sapiens],4X45_B Crystal Structure of F173G Mutant of Human APRT [Homo sapiens]
4X44_A	7.37e-16	946	1127	1	168	Crystal Structure of Mutant R89Q of human Adenine phosphoribosyltransferase [Homo sapiens]
1ORE_A	7.37e-16	946	1127	1	168	Human Adenine Phosphoribosyltransferase [Homo sapiens],1ZN7_A Human Adenine Phosphoribosyltransferase Complexed with PRPP, ADE and R5P [Homo sapiens],1ZN7_B Human Adenine Phosphoribosyltransferase Complexed with PRPP, ADE and R5P [Homo sapiens],1ZN8_A Human Adenine Phosphoribosyltransferase Complexed with AMP, in Space Group P1 at 1.76 A Resolution [Homo sapiens],1ZN8_B Human Adenine Phosphoribosyltransferase Complexed with AMP, in Space Group P1 at 1.76 A Resolution [Homo sapiens],1ZN9_A Human Adenine Phosphoribosyltransferase in Apo and AMP Complexed Forms [Homo sapiens],1ZN9_B Human Adenine Phosphoribosyltransferase in Apo and AMP Complexed Forms [Homo sapiens]
6FCH_A	1.30e-15	948	1127	1	166	Crystal Structure of Human APRT wild type in complex with PRPP and Mg2+ [Homo sapiens],6FCH_B Crystal Structure of Human APRT wild type in complex with PRPP and Mg2+ [Homo sapiens],6FCL_A Crystal Structure of Human APRT wild type in complex with AMP [Homo sapiens],6FCL_B Crystal Structure of Human APRT wild type in complex with AMP [Homo sapiens],6HGP_A Crystal Structure of Human APRT wild type in complex with Phosphate ion. [Homo sapiens],6HGP_B Crystal Structure of Human APRT wild type in complex with Phosphate ion. [Homo sapiens],6HGR_A Crystal Structure of Human APRT wild type in complex with IMP [Homo sapiens],6HGR_B Crystal Structure of Human APRT wild type in complex with IMP [Homo sapiens],6HGS_A Crystal Structure of Human APRT wild type in complex with GMP [Homo sapiens],6HGS_B Crystal Structure of Human APRT wild type in complex with GMP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54H55|Y8969_DICDI	5.38e-27	300	737	45	439	FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289697 PE=2 SV=1
sp|P91455|APT_CAEEL	6.66e-20	944	1146	3	185	Adenine phosphoribosyltransferase OS=Caenorhabditis elegans OX=6239 GN=T19B4.3 PE=2 SV=1
sp|P36972|APT_RAT	5.06e-19	948	1127	3	168	Adenine phosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Aprt PE=1 SV=1
sp|P47952|APT_CRIGR	9.37e-19	946	1144	1	180	Adenine phosphoribosyltransferase OS=Cricetulus griseus OX=10029 GN=APRT PE=3 SV=2
sp|Q64427|APT_MASNA	1.73e-18	948	1144	3	180	Adenine phosphoribosyltransferase OS=Mastomys natalensis OX=10112 GN=APRT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RAK72133.1.