CAZyme Information: RAK71792.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK71792.1
• CAZy Family: AA3
• CAZyme Description: beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
894	KZ824709|CGC1	97091.98	7.0672

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824709:5183-8121(+)

Full Sequence      

MALGQADGATFHDGLRWNIAAEDATRLVLELQTIARDAGHPVPLLIALDQENGGVNSLYD
DIYIRQYPSAMGIAATGSKSLAHEVAMATAQELKAVGVNWILGPVLDVLTNVRNQPLGVR
TTGDDPQEVSQYGVEFMKGYQKAGLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLT
ALVPFRNAILHGLDSMMVGGVSMSSAGVNVMHACLSEQVVDDLLRKDLQFKGVVVSECLE
MEALTHNIGVGGGTVMAKNAGCDIILLCRSFQVQQEAISGLKLGVENGIIGRGRIEQSLR
RVLSLKAKCTSWEQALSPPGLTLLTQMQPSHTSLSIRAYNSSISVVRDKQNLLPLTNILE
QNEELLLLTPLVKPLPASAVSRSVNEHLNVSLDPIAWDRTASVLSGESVFKELGRSLSRH
RSGRVLHTSYTANGVRPIHEDLIDRASAVIVVTADANRNLYQHGFTRHVSMICRSKFTPS
GEPREKPLIVVAASSPYDFAMDLSIGTYLCTYDFTEAALEALVKVLYGELTAVGSLPGSI
SRSQKLHQARQHWLVESWNEDRDAHALDSLLNAVRDDCVQGQRPELLGVTSTSFLLRKEE
IDEAHFVVRNSSTQALYGFCSTYYFRSTGTGVIGSLIVHPARRKLSIGNSLHNRAIRTLL
HRKGMRRFQLGSRLPGIYLGIPSANPVDRKRLRQWFANLGWNTALSRPVCSAVLRNLSSW
TPTDSLVHGIQHADVAYDLVYGWDYADSILDHIGTNSRQGVLDIYKVALRGSPHCGIIRA
TRPGNGAILGSVVVYNGRAALAEHMPVLRSLQIAAGGISSPVISPSVGEYATVMQGLILL
GIKQIRKQGAEAVIMDCIDGDSNLDCLSGMGFSALHSFEEINCDAATWTMAPSS

Enzyme Prediction     

No EC number prediction in RAK71792.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	266	3.9e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.03e-61	14	356	35	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.53e-52	22	305	46	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.11e-28	36	316	50	316	beta-hexosaminidase; Provisional
178629	PLN03080	5.55e-09	67	355	114	415	Probable beta-xylosidase; Provisional
185053	PRK15098	7.92e-08	66	306	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47105.1|GH3	0.0	20	892	233	1105
BCS15461.1|GH3	0.0	20	894	57	931
BCS03847.1|GH3	0.0	20	894	39	913
BAE65506.1|GH3	0.0	20	894	86	961
QRD92904.1|GH3	0.0	20	894	39	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.23e-75	18	701	48	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.53e-53	26	541	61	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.32e-35	25	540	99	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.87e-35	25	540	73	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.46e-35	25	540	103	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	6.77e-35	25	540	99	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	3.35e-33	19	537	65	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.10e-27	31	541	87	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|B0U3L0|NAGZ_XYLFM	4.25e-25	28	295	40	309	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	1.91e-24	28	293	40	307	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in RAK71792.1.