CAZyme Information: RAK71753.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK71753.1
• CAZy Family: AA3
• CAZyme Description: endoglucanase II

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		36087.27	4.0605

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824710:14323-15563(+)

Full Sequence      

MKLLDLLVAAAAAGSAVAAPTHEHTKRASVFEWIGSNESGAEFGTAIPGTWGIDYIFPDT
SAIATLVSKGMNIFRVQFMMERLVPNSMTGSYDEAYLNNLTTVVNAITAAGVHAIVDPHN
YGRYNNEIISSTADFQTFWQNLAGQFKDNDLVIFDTNNEYNTMDQTLVLDLNQAAIDGIR
AAGATSQYIFAEGNSWSGAWTWADINDNMKALTDPQDKLVYEMHQYLDSDGSGTSGVCVS
ETIGAERLQAATQWLKDNGKVGILGEYAGGANDVCRTAIAGMLEYMANNTDVWKGAVWWA
AGPWWADYMFSMEPPSGPAYSGMLDVLEPYLG

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	33	309	1.6e-108	0.9964539007092199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.64e-76	37	302	2	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.78e-16	29	314	43	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN16396.1|GH5_5	1.73e-245	1	332	1	332
AAC08587.1|GH5_5	8.24e-244	1	332	1	332
AAN75019.1|GH5_5	8.72e-228	28	332	1	305
AII80538.1|GH5_5	1.09e-223	34	332	34	332
BAB62319.1|GH5_5	1.50e-198	1	331	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	8.27e-192	30	331	1	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	7.30e-191	30	331	3	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	7.57e-191	30	331	4	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	3.54e-168	30	331	2	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	7.05e-166	28	331	1	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96WQ8|EGLB_ASPKW	2.66e-199	1	331	1	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|A2QPC3|EGLB_ASPNC	9.50e-195	1	331	1	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	9.50e-195	1	331	1	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1
sp|A1DME8|EGLB_NEOFI	2.81e-191	1	332	1	329	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|B8MW97|EGLB_ASPFN	4.89e-186	1	332	1	333	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999597	CS pos: 27-28. Pr: 0.5733

TMHMM  Annotations     

There is no transmembrane helices in RAK71753.1.