CAZyme Information: RAK71308.1

Basic Information

• Species: Aspergillus fijiensis
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fijiensis
• CAZyme ID: RAK71308.1
• CAZy Family: AA1
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1085	KZ824726|CGC1	117229.36	6.8253

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfijiensisCBS313.89	12336	1448319	318	12018

• Gene Location: location=KZ824726:30616-34418(-)

Full Sequence      

MRWLPSLLGAIALLPLSEATSCWRNTTCSGPTTAAFPGSWEKNIFAPASRTVNPETLFLV
TKPDVTHEYAQYKLQGNGSLVVYDFGREVGGIVTVKYTSTGSGALGLAFTEAKDYIGEWS
DSSNGGFKGPDGALYGNFTEAGEHSYTMPDKYLRGGFRYLTLFLITDNSTAVQIKDVSLE
IGFQPTWSNLRAYQGYFDSSDDLLNAIWYSGAYTLQTNEVPVNTGRQIPAMPAGWANNAT
LGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSIGNLESVKNALQASTGAFDESGPPLSQ
KNSDTYHMWSMVGTYNYLLYTNDTSFLETNWAGYQKAMEYIYGAELATWAGDTTGLSDTY
TTRAEKLREAINEYCWDDSYGAFKDNATDTTLHPQDANSMALLFGVVDSERAASISEKLT
ENWTPIGAVAPELPENISPFISSFEIQGHFTVGQPARALELIRRSWGWYYNNENGTQSTV
IEGYLQNGTFGYRSSRGYYYDTAYVSHAHGWSSGPTSALTNYIVGLTVTSPVGATWKLAP
QFGDLKTAQAGFTTSLGQFQASWTKQSNEYSLQFTVPKGTTGSLALPYLNSKKPTITIDG
KKITKGVSYANNTATVAVASGGSHKGIAMPWRTCNQCIRRHYLLSRGGGRPQSRLHLSTT
SPVRSSSGSSSSSSNPSNPLRTSRVRSTEKDVANYRRSMILSASGIAACAIAMYGIIKLD
LFGLEQTKQQQQSSSITATIPTAQEAPSPKKTQLDGPNGFPSSPSLITVHGQDPGAEQVA
TGTSSVPYFPATIRLPKALDAENIGLAAGDEIALSTAAEKPADEEEYQLLGLGIRTVSFL
RIQVYVVGMYVAKSDITALQRRLVQTAVNPPTLAGVIEAETKGDGGVITNPVGATAATSL
VSTERDRLRQLLLDAGSSSGGGEQQGDLVWDAILREPGLRTAFRIVPVRNTDFTHMRDAF
VRGVTARAQKYNPWRGEFADEAFGAAVKTFKALFGGGANKNVPKGHTVLLVRNSRGQLDA
LYQTDVADKPTRYMGRVADERVSRLVWLNYLAGKNVSSEPARESVVEGIMAVVERPVGTV
VQKVL

Enzyme Prediction     

EC	3.2.1.174:2	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	342	585	7.5e-48	0.4444444444444444
GH78	80	342	2e-36	0.4603174603174603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406443	Chalcone_2	3.11e-86	825	1066	1	203	Chalcone isomerase like.
379972	Bac_rhamnosid_C	1.28e-05	530	587	3	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	6.77e-05	195	421	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43282.1|GH78	0.0	1	1080	1	1131
UCK57529.1|GH78	1.42e-316	4	625	10	682
QRD88907.1|GH78	5.83e-316	4	625	10	682
QMW37218.1|GH78	7.55e-316	4	625	7	670
QMW25160.1|GH78	7.55e-316	4	625	7	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.89e-12	81	557	194	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BN19|AIM18_DEBHA	2.06e-19	803	1070	71	295	Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=AIM18 PE=3 SV=1
sp|Q75DU9|AIM18_ASHGO	4.70e-14	824	1073	97	304	Altered inheritance of mitochondria protein 18, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AIM18 PE=3 SV=1
sp|C5DRI2|AIM18_ZYGRC	5.50e-13	826	1071	106	310	Altered inheritance of mitochondria protein 18, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) OX=559307 GN=AIM18 PE=3 SV=1
sp|C5DFS5|AIM18_LACTC	5.55e-11	826	1073	99	305	Altered inheritance of mitochondria protein 18, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) OX=559295 GN=AIM18 PE=3 SV=1
sp|A7TPW4|AIM18_VANPO	1.49e-10	826	1073	110	316	Altered inheritance of mitochondria protein 18, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17) OX=436907 GN=AIM18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000279	0.999712	CS pos: 19-20. Pr: 0.9735

TMHMM  Annotations     

There is no transmembrane helices in RAK71308.1.