CAZyme Information: QYA_86382T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_86382T0-p1
• CAZy Family: GT77
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A168H2S0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	McirCBS277-49_SC11|CGC2	85878.99	7.6344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC11:900970-903568(-)

Full Sequence      

MKLSVSIVLTVSVLLSCQQLQATSSSMKTSNHLLEPVDVSTPAPPSVFPSIQHPFPPVYA
DPKFKAVVPTSSWISNLFYPSVNNLAPTTPDPYILRLLDDFGGNPGLSISQPHDKVIGSY
PAMNNIPPSPAGYIINGVVVDLRLTAQEWTNKAAAPEPLVTQWGHFNAHLRLSGGNGKVE
FPLVRGQSFITAAYTGLTPQFFTQHAIIHVTADQQGGDVYTGKKFKVSFNDNPTSTYLIY
ALDGPLTLTKQGMNNLVASDKYNGVIQVAKLPSAQDEATLDAHHGVWPTSATIDTSKDGQ
YYMTHQPHSFYRSKYTIDWHKAGDVSKPLLTYAYPHHLKSFSLHTVTKTNLILQSSSKGP
MQAVIGDQWTLQESDLSRIEWFPERASPERSTHNEILQQLASDVESNYTQHTQRGDNYFS
GKGLQKVALTALVLNEPDITGLRNPELAQVALDKLKRAFIPYLENRQQDPFRYDSVYKGI
VSLAGLPVEMGGTGNKDAAFGHSYYNDHHYHQGYFVVTAAIIHHLDPSWRAQELKAWTET
LIRDVNNPVENDAYFAQFRNWDWFAGHSWAGGIKVDGALDGRDQESVPESVNFYWGTKLW
GLATKNKAMQDLANLQLAVTKRTTYEYFWMLDGNKNRPKHMTTYFGRYLEYIHGIQQLPM
TPILADYMRTPEFVSQEWDQKLASVAPTIDSPWAGVLYLNYATINPAIAYPILRHIAIDD
GQTRSYSLYMAATRPNFYRRSFSKYLREKTRKLKLSIKEQEKDT

Enzyme Prediction     

No EC number prediction in QYA_86382T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	54	729	5.1e-145	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	8.18e-128	20	732	42	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	2.02e-127	391	728	5	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.87e-54	53	383	1	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGV00786.1|GH81	0.0	37	741	35	750
CDS06153.1|GH81	0.0	24	739	13	734
UJR31943.1|GH81	1.12e-119	9	736	14	715
AIG55599.1|GH81	3.52e-98	68	734	97	754
AIU47332.1|GH81	3.90e-98	33	710	85	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K35_A	0.0	37	741	10	725	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K3A_A	0.0	37	741	10	725	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	0.0	37	741	35	750	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
6FOP_A	1.07e-27	219	727	137	649	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.66e-14	506	720	439	664	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.66e-94	68	732	226	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.03e-93	39	732	52	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	2.92e-87	47	732	15	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.99e-72	25	728	68	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.84e-66	160	732	547	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000286	0.999706	CS pos: 16-17. Pr: 0.7583

TMHMM  Annotations     

There is no transmembrane helices in QYA_86382T0-p1.