CAZyme Information: QYA_83367T0-p1

Basic Information

• Species: Mucor lusitanicus
• Lineage: Mucoromycota; Mucoromycetes; ; Mucoraceae; Mucor; Mucor lusitanicus
• CAZyme ID: QYA_83367T0-p1
• CAZy Family: GT71
• CAZyme Description: Dimeric dihydrodiol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	McirCBS277-49_SC06|CGC7	38197.64	5.6116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MlusitanicusCBS277-49	11852	747725	0	11852

• Gene Location: location=McirCBS277-49_SC06:3132181-3133278(+)

Full Sequence      

MLKWGIIGTGNIAHTFAKALQVAKKGELVAVGSRSIATAEKFAQEFNVKHSFGSYNELLA
FDQVDIVYICTPHPQHYELALTTAKAGKHMLIEKPMAMTETQIKTILDTAKEHNLFVMEA
YMYRCHPQTLKVVELIQSGAIGQVKLIRANFSFDGRPLGPSSRLWRNELGGGAIMDIGGY
PMSFCRLIAGVANDKSGAYSGGGANPIKVKATGYIQPDTKVDEWSNASVEFEGNITAQLF
TGIFADTDCSVEVLGSEGSLKVVNLWRPDLAVLGPVQIDLTEYGKETKVIPVELQETNLF
AYEADAVADAIAQGQHECKYMNWQDTLGQAHAMDAWRKEIGLVYKEDQ

Enzyme Prediction     

No EC number prediction in QYA_83367T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	160	1e-21	0.41854636591478694

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	1.16e-68	1	317	3	311	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	4.51e-29	2	121	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
275173	myo_inos_iolG	2.00e-21	1	157	1	157	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
397743	F420_oxidored	4.26e-11	5	78	1	71	NADP oxidoreductase coenzyme F420-dependent.
183212	PRK11579	6.05e-09	2	173	5	171	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO12039.2|GT4	1.17e-15	1	182	1	185
URK87275.1|GH9	8.16e-11	7	266	178	440
BBH24254.1|GH109	1.99e-10	1	169	6	177
QOY90270.1|GH0	1.51e-09	4	171	36	222
QDU45421.1|GH0	1.68e-09	1	155	48	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O48_X	2.82e-36	2	348	3	333	Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2O4U_X Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2POQ_X Dimeric Dihydrodiol Dehydrogenase complexed with inhibitor, Isoascorbic acid [Macaca fascicularis],3OHS_X Crystal Structure of Mammalian Dimeric Dihydrodiol Dehydrogenase in complex with Dihydroxyacetone [Macaca fascicularis]
4HAD_A	1.48e-35	2	317	24	321	Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]
3RBV_A	4.06e-33	2	344	28	348	Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP [Actinomadura kijaniata],3RC1_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP and TDP-benzene [Actinomadura kijaniata],3RC2_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP; open conformation [Actinomadura kijaniata]
3RCB_A	1.51e-32	2	344	28	348	Crystal structure of the K102E mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
3RC7_A	1.51e-32	2	344	28	348	Crystal Structure of the Y186F mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q642M9|DHDH_DANRE	1.71e-54	2	347	3	332	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Danio rerio OX=7955 GN=dhdh PE=2 SV=2
sp|Q6DKE0|DHDH_XENLA	1.80e-48	3	344	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis OX=8355 GN=dhdh PE=2 SV=1
sp|Q6DF30|DHDH_XENTR	5.75e-46	3	344	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis OX=8364 GN=dhdh PE=2 SV=1
sp|Q9DBB8|DHDH_MOUSE	3.81e-43	2	348	3	332	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Mus musculus OX=10090 GN=Dhdh PE=1 SV=1
sp|Q148L6|DHDH_BOVIN	2.71e-37	2	348	3	334	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Bos taurus OX=9913 GN=DHDH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QYA_83367T0-p1.